RAB32 Antibody - #DF9825
| Product: | RAB32 Antibody |
| Catalog: | DF9825 |
| Description: | Rabbit polyclonal antibody to RAB32 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Horse, Rabbit |
| Mol.Wt.: | 25 kDa; 25kD(Calculated). |
| Uniprot: | Q13637 |
| RRID: | AB_2843019 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9825, RRID:AB_2843019.
Fold/Unfold
RAB32; RAB32, member RAS oncogene family; RAB32_HUMAN; Ras related protein Rab32; Ras-related protein Rab-32;
Immunogens
A synthesized peptide derived from human RAB32, corresponding to a region within C-terminal amino acids.
Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung.
- Q13637 RAB32_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as an A-kinase anchoring protein by binding to the type II regulatory subunit of protein kinase A and anchoring it to the mitochondrion. Also involved in synchronization of mitochondrial fission. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays an important role in the control of melanin production and melanosome biogenesis. In concert with RAB38, regulates the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes (By similarity).
Mitochondrion. Mitochondrion outer membrane>Lipid-anchor. Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side. Melanosome. Melanosome membrane.
Note: Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211). The BLOC-3 complex, a heterodimer of HPS1 and HPS4 promotes its membrane localization (PubMed:23084991).
Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.