RAB36 Antibody - #DF9827
| Product: | RAB36 Antibody |
| Catalog: | DF9827 |
| Description: | Rabbit polyclonal antibody to RAB36 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 36 kDa; 36kD(Calculated). |
| Uniprot: | O95755 |
| RRID: | AB_2843021 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9827, RRID:AB_2843021.
Fold/Unfold
RAB 36; Rab36; RAB36 member RAS oncogene family; RAB36_HUMAN; Ras related protein Rab 36; Ras related protein Rab36; Ras-related protein Rab-36; Small GTP binding protein Rab36;
Immunogens
A synthesized peptide derived from human RAB36, corresponding to a region within N-terminal amino acids.
- O95755 RAB36_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVIAGASWMLGRAAASPTQTPPTTSTIRVARRSRVALVAMVIAAAGSGGPGRAEPQLSQPSLDCGRMRSSLTPLGPPVSRDRVIASFPKWYTPEACLQLREHFHGQVSAACQRRNTGTVGLKLSKVVVVGDLYVGKTSLIHRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEADAVHLAREMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLERQSSARLQVGNGDLIQMEGSPPETQESKRPSSLGCC
Research Backgrounds
Protein transport. Probably involved in vesicular traffic (By similarity).
Golgi apparatus membrane>Lipid-anchor.
Ubiquitously present in all tissues examined.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.