RARRES3 Antibody - #DF9854
| Product: | RARRES3 Antibody |
| Catalog: | DF9854 |
| Description: | Rabbit polyclonal antibody to RARRES3 |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 18 kDa; 18kD(Calculated). |
| Uniprot: | Q9UL19 |
| RRID: | AB_2843048 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9854, RRID:AB_2843048.
Fold/Unfold
HRASLS4; MGC8906; RAR responsive protein TIG3; RAR-responsive protein TIG3; RARRES3; Retinic acid inducible gene 1; Retinoic acid receptor responder (tazarotene induced) 3; Retinoic acid receptor responder protein 3; Retinoid inducible gene 1 protein; Retinoid-inducible gene 1 protein; RIG 1; rig1; Tazarotene induced gene 3 protein; Tazarotene-induced gene 3 protein; TIG 3; TIG3; TIG3_HUMAN;
Immunogens
A synthesized peptide derived from human RARRES3, corresponding to a region within the internal amino acids.
- Q9UL19 PLAT4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Research Backgrounds
Exhibits both phospholipase A1/2 and acyltransferase activities. Shows phospholipase A1 (PLA1) and A2 (PLA2), catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids. For most substrates, PLA1 activity is much higher than PLA2 activity. Shows O-acyltransferase activity, catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid. Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs). Promotes keratinocyte differentiation via activation of TGM1.
Membrane>Single-pass membrane protein.
Widely expressed.
Belongs to the H-rev107 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.