RHOF Antibody - #DF9866
| Product: | RHOF Antibody |
| Catalog: | DF9866 |
| Description: | Rabbit polyclonal antibody to RHOF |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | Q9HBH0 |
| RRID: | AB_2843060 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9866, RRID:AB_2843060.
Fold/Unfold
ARHF; FLJ20247; Ras homolog gene family member F (in filopodia); Ras homolog gene family member F; Rho F; Rho family GTPase Rif; Rho in filopodia; Rho related GTP binding protein RhoF; Rho-related GTP-binding protein RhoF; Rhof; RHOF_HUMAN; RIF;
Immunogens
A synthesized peptide derived from human RHOF, corresponding to a region within the internal amino acids.
- Q9HBH0 RHOF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology.
Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasm>Cytoskeleton.
Belongs to the small GTPase superfamily. Rho family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.