CCL1 Antibody - #DF9910

Product: | CCL1 Antibody |
Catalog: | DF9910 |
Description: | Rabbit polyclonal antibody to CCL1 |
Application: | WB IHC |
Cited expt.: | WB |
Reactivity: | Human |
Mol.Wt.: | 11 kDa; 11kD(Calculated). |
Uniprot: | P22362 |
RRID: | AB_2843104 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9910, RRID:AB_2843104.
Fold/Unfold
C-C motif chemokine 1; Ccl1; CCL1_HUMAN; Chemokine CC Motif Ligand 1; inflammatory cytokine I-309; P500; SCYA1; SISe; small inducible cytokine A1; Small-inducible cytokine A1; T lymphocyte secreted protein I-309; T lymphocyte secreted protein I-309; T lymphocyte-secreted protein I-309; TCA3;
Immunogens
A synthesized peptide derived from human CCL1, corresponding to a region within the internal amino acids.
- P22362 CCL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Research Backgrounds
Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
Secreted.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
References
Application: WB Species: Mouse Sample:
Application: IF/ICC Species: human Sample: CSCC
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.