Product: CCL16 Antibody
Catalog: DF9912
Description: Rabbit polyclonal antibody to CCL16
Application: WB
Reactivity: Human
Mol.Wt.: 14 kDa; 14kD(Calculated).
Uniprot: O15467
RRID: AB_2843106

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
CCL16 Antibody detects endogenous levels of total CCL16.
RRID:
AB_2843106
Cite Format: Affinity Biosciences Cat# DF9912, RRID:AB_2843106.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C-C motif chemokine 16; CCL16; CCL16_HUMAN; Chemokine (C-C motif) ligand 16; Chemokine CC-4; Chemokine LEC; CKb12; HCC-4; HCC4; IL-10-inducible chemokine; IL10 inducible chemokine; IL10 inducible chemokine; ILINCK; LCC-1; LCC1; Liver CC chemokine 1 precursor; Liver expressed chemokine; Liver-expressed chemokine; LMC; Lymphocyte and monocyte chemoattractant; Monotactin 1; Monotactin-1; MTN-1; Mtn1; NCC-4; NCC4; New CC chemokine 4; SCYA16; SCYL4; Small inducible cytokine A16 precursor; Small inducible cytokine A16 precursor; Small inducible cytokine subfamily A (Cys Cys) member 16; Small-inducible cytokine A16;

Immunogens

Immunogen:

A synthesized peptide derived from human CCL16, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O15467 CCL16_HUMAN:

Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.

Sequence:
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Research Backgrounds

Function:

Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.

Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.