CCL17 Antibody - #DF9913
| Product: | CCL17 Antibody |
| Catalog: | DF9913 |
| Description: | Rabbit polyclonal antibody to CCL17 |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Pig, Horse, Rabbit, Dog |
| Mol.Wt.: | 11 kDa; 11kD(Calculated). |
| Uniprot: | Q92583 |
| RRID: | AB_2843107 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9913, RRID:AB_2843107.
Fold/Unfold
A-152E5.3; A152E53; ABCD 2; ABCD2; C-C motif chemokine 17; CC chemokine TARC; CCL17; CCL17_HUMAN; Chemokine CC Motif Ligand 17; MGC138271; MGC138273; SCYA17; Small Inducible Cytokine A17; Small Inducible Cytokine A17 Precursor; Small Inducible Cytokine Subfamily A (Cys Cys); Small Inducible Cytokine Subfamily A (Cys Cys) Member 17; Small-inducible cytokine A17; T Cell Directed CC Chemokine; Thymus and activation regulated chemokine; Thymus and activation-regulated chemokine;
Immunogens
A synthesized peptide derived from human CCL17, corresponding to a region within the internal amino acids.
Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
- Q92583 CCL17_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.
Secreted.
Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.