CCL26 Antibody - #DF9915
| Product: | CCL26 Antibody |
| Catalog: | DF9915 |
| Description: | Rabbit polyclonal antibody to CCL26 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 11 kDa; 11kD(Calculated). |
| Uniprot: | Q9Y258 |
| RRID: | AB_2843109 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9915, RRID:AB_2843109.
Fold/Unfold
C-C motif chemokine 26; CC chemokine IMAC; CCL 26; CCL26; CCL26_HUMAN; Chemokine (C C motif) ligand 26; chemokine N1; Eotaxin-3; IMAC; Macrophage inflammatory protein 4-alpha; MIP 4a; MIP 4alpha; MIP-4-alpha; MIP4a; MIP4alpha; SCYA 26; SCYA26; Small inducible cytokine A26; Small inducible cytokine subfamily A (Cys Cys) member 26; Small inducible cytokine subfamily A member 26; Small-inducible cytokine A26; Thymic stroma chemokine 1; Thymic stroma chemokine-1; TSC 1; TSC-1; TSC1;
Immunogens
A synthesized peptide derived from human CCL26, corresponding to a region within the internal amino acids.
Ubiquitously expressed at low levels in various tissues including heart and ovary.
- Q9Y258 CCL26_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Research Backgrounds
Chemoattractant for eosinophils and basophils. Acts as a ligand for C-C chemokine receptor CCR3 which triggers Ca(2+) mobilization in eosinophils.
Secreted.
Ubiquitously expressed at low levels in various tissues including heart and ovary.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.