CXCL9 Antibody - #DF9920

Product: | CXCL9 Antibody |
Catalog: | DF9920 |
Description: | Rabbit polyclonal antibody to CXCL9 |
Application: | WB IHC |
Reactivity: | Human |
Mol.Wt.: | 10 kDa; 14kD(Calculated). |
Uniprot: | Q07325 |
RRID: | AB_2843114 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9920, RRID:AB_2843114.
Fold/Unfold
C-X-C motif chemokine 9; chemokine (C-X-C motif) ligand 9; CMK; crg-10; CXCL9; CXCL9_HUMAN; gamma interferon induced monokine; Gamma-interferon-induced monokine; HuMIG; MIG; monokine induced by gamma interferon; monokine induced by interferon gamma; Monokine induced by interferon-gamma; SCYB9; Small inducible cytokine B9; small inducible cytokine subfamily B member 9; Small-inducible cytokine B9;
Immunogens
- Q07325 CXCL9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
PTMs - Q07325 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K97 | Ubiquitination | Uniprot | |
K107 | Ubiquitination | Uniprot |
Research Backgrounds
Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
Secreted.
Belongs to the intercrine alpha (chemokine CxC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)
References
Application: IHC Species: Human Sample: OC tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.