LSM2 Antibody - #DF9979
| Product: | LSM2 Antibody |
| Catalog: | DF9979 |
| Description: | Rabbit polyclonal antibody to LSM2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Xenopus |
| Mol.Wt.: | 11 kDa; 11kD(Calculated). |
| Uniprot: | Q9Y333 |
| RRID: | AB_2843171 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9979, RRID:AB_2843171.
Fold/Unfold
C6orf28; Chromosome 6 open reading frame 28; G7b; LSM 2; Lsm2; LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae); Lsm2 protein; LSM2_HUMAN; OTTHUMP00000029159; Protein G7b; Small nuclear ribonuclear protein D homolog; snRNP; snRNP core Sm like protein Sm x5; snRNP core Sm-like protein Sm-x5; U6 snRNA associated Sm like protein LSm2; U6 snRNA-associated Sm-like protein LSm2; YBL026W;
Immunogens
A synthesized peptide derived from human LSM2, corresponding to a region within the internal amino acids.
- Q9Y333 LSM2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.
Nucleus.
Belongs to the snRNP Sm proteins family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.