CD158f2 Antibody - #AF9037
| Product: | CD158f2 Antibody |
| Catalog: | AF9037 |
| Description: | Rabbit polyclonal antibody to CD158f2 |
| Application: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 40kDa; 41kD(Calculated). |
| Uniprot: | Q8NHK3 |
| RRID: | AB_2843228 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9037, RRID:AB_2843228.
Fold/Unfold
CD_antigen=CD158f2; CD158 antigen-like family member F2; CD158F; CD158f2; Killer cell immunoglobulin-like receptor 2DL5B; Killer cell immunoglobulin-like receptor 2DLX; KIR2DL5; KIR2DL5B; KIR2DLX;
Immunogens
A synthesized peptide derived from human CD158f2, corresponding to a region within the internal amino acids.
- Q8NHK3 KI2LB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLMVVSMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVDGTFQADFPLGPATHGGTYTCFSSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Research Backgrounds
Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
Cell membrane>Single-pass type I membrane protein.
Belongs to the immunoglobulin superfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.