DHHC-9 Antibody - #AF9054
Product: | DHHC-9 Antibody |
Catalog: | AF9054 |
Description: | Rabbit polyclonal antibody to DHHC-9 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Rabbit |
Mol.Wt.: | 41kDa; 41kD(Calculated). |
Uniprot: | Q9Y397 |
RRID: | AB_2843245 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9054, RRID:AB_2843245.
Fold/Unfold
Antigen MMSA 1; Asp His His Cys domain containing protein 9; CGI89; CXorf11; DHHC-9; DHHC9; MMSA1; MRXSZ; Palmitoyltransferase ZDHHC9; ZDHC9_HUMAN; ZDHHC 9; ZDHHC10; ZDHHC9; Zinc finger DHHC domain containing 10; Zinc finger DHHC domain containing protein 9; Zinc finger DHHC domain-containing protein 9; Zinc finger DHHC type containing 9; Zinc finger protein 379; Zinc finger protein 380; ZNF379; ZNF380;
Immunogens
A synthesized peptide derived from human DHHC-9, corresponding to a region within C-terminal amino acids.
Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes.
- Q9Y397 ZDHC9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Endoplasmic reticulum membrane>Multi-pass membrane protein. Golgi apparatus membrane>Multi-pass membrane protein.
Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes.
The DHHC domain is required for palmitoyltransferase activity.
Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.