Product: GPR41 Antibody
Catalog: AF9075
Description: Rabbit polyclonal antibody to GPR41
Application: WB IHC
Cited expt.: IHC
Reactivity: Human, Rat
Mol.Wt.: 35-45kDa(Observed); 39kD(Calculated).
Uniprot: O14843
RRID: AB_2843266

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Rat
Clonality:
Polyclonal
Specificity:
GPR41 Antibody detects endogenous levels of total GPR41.
RRID:
AB_2843266
Cite Format: Affinity Biosciences Cat# AF9075, RRID:AB_2843266.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FFA3R; Ffar3; FFAR3_HUMAN; Free fatty acid receptor 3; G protein coupled receptor 41; G-protein coupled receptor 41; gpcr41; GPR41; gpr42;

Immunogens

Immunogen:

A synthesized peptide derived from human GPR41, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O14843 FFAR3_HUMAN:

Highest level in adipose tissue, and lower expression across all tissues tested. Expressed in sympathetic ganglia.

Sequence:
MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

Research Backgrounds

Function:

G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous mammals, the short chain fatty acids acetate, propionate and butyrate are produced primarily by the gut microbiome that metabolizes dietary fibers. SCFAs serve as a source of energy but also act as signaling molecules. That G protein-coupled receptor is probably coupled to the pertussis toxin-sensitive, G(i/o)-alpha family of G proteins. Its activation results in the formation of inositol 1,4,5-trisphosphate, the mobilization of intracellular calcium, the phosphorylation of the MAPK3/ERK1 and MAPK1/ERK2 kinases and the inhibition of intracellular cAMP accumulation. Activated by SCFAs and by beta-hydroxybutyrate, a ketone body produced by the liver upon starvation, it inhibits N-type calcium channels and modulates the activity of sympathetic neurons through a signaling cascade involving the beta and gamma subunits of its coupled G protein, phospholipase C and MAP kinases. Thereby, it may regulate energy expenditure through the control of the sympathetic nervous system that controls for instance heart rate. Upon activation by SCFAs accumulating in the intestine, it may also signal to the brain via neural circuits which in turn would regulate intestinal gluconeogenesis. May also control the production of hormones involved in whole-body energy homeostasis. May for instance, regulate blood pressure through renin secretion. May also regulate secretion of the PYY peptide by enteroendocrine cells and control gut motility, intestinal transit rate, and the harvesting of energy from SCFAs produced by gut microbiota. May also indirectly regulate the production of LEP/Leptin, a hormone acting on the CNS to inhibit food intake, in response to the presence of short-chain fatty acids in the intestine. Finally, may also play a role in glucose homeostasis. Besides its role in energy homeostasis, may play a role in intestinal immunity. May mediate the activation of the inflammatory and immune response by SCFAs in the gut, regulating the rapid production of chemokines and cytokines by intestinal epithelial cells. Among SCFAs, the fatty acids containing less than 6 carbons, the most potent activators are probably propionate, butyrate and pentanoate while acetate is a poor activator.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highest level in adipose tissue, and lower expression across all tissues tested. Expressed in sympathetic ganglia.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

References

1). Butyrylated modification of corn starch alleviates autism-like behaviors by modulating 5-hydroxytryptamine metabolism and gut-brain neural activity. Carbohydrate polymers, 2025 (PubMed: 39779003) [IF=10.7]

2). Alteration of Gastrointestinal Function and the Ameliorative Effects of Hericium erinaceus Polysaccharides in Tail Suspension Rats. Nutrients, 2025 (PubMed: 40005052) [IF=5.9]

Application: IHC    Species: Rat    Sample: colon

Figure 9. Hericium erinaceus polysaccharides (HEP) on the content of short-chain fatty acids and their receptor expression in rats. (A) Serum levels of SCFAs (acetic acid, propionic acid, and butyric acid) in rats. (B) Immunohistochemical staining of GPR41 and GPR43 in the colon of rats (scale bar = 20 μm). (C) Percentage of cells positive for GPR41 and GPR43. Data are mean ± SEM. * p < 0.05, ** p < 0.01, and **** p < 0.0001. ns indicates no significant change. Statistical analysis was performed with one-way ANOVA followed by Tukey’s multiple comparisons test.

3). Impaired gut barrier integrity and reduced colonic expression of free fatty acid receptors in patients with Parkinson's disease. Neurological sciences : official journal of the Italian Neurological Society and of the Italian Society of Clinical Neurophysiology, 2024 (PubMed: 38862654) [IF=2.7]

4). Seasonal expressions of GPR41 and GPR43 in the colon of the wild ground squirrels (Spermophilus dauricus). European Journal of Histochemistry : EJH, 2022 (PubMed: 35057584) [IF=2.1]

Application: IHC    Species: Mice    Sample: colon tissues

Figure 2.Immunohistochemistry of GPR41 and GPR43 in the colon of the wild ground squirrels between the breeding and non-breeding seasons. a) Immunolocalization of the GPR41 in the breeding season. b) Immunolocalization of the GPR43 in the breeding season. c) Negative control of the breeding season. d) Immunolocalization of the GPR41 in the non-breeding season. e) Immunolocalization of the GPR43 in the non-breeding season. f ) Negative control of the non-breeding season. B, breeding season; NB, non-breeding season; GC, goblet cell; iEC, intestinal epithelial cells.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.