MCT12 Antibody - #AF9110
| Product: | MCT12 Antibody |
| Catalog: | AF9110 |
| Description: | Rabbit polyclonal antibody to MCT12 |
| Application: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 53kDa; 56kD(Calculated). |
| Uniprot: | Q6ZSM3 |
| RRID: | AB_2843300 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9110, RRID:AB_2843300.
Fold/Unfold
CJMG; DKFZp686E188; MCT 12; MCT12; Monocarboxylate transporter 12; MOT12_HUMAN; OTTHUMP00000020064; Slc16a12; Solute carrier family 16 member 12; Solute carrier family 16, member 12 (monocarboxylic acid transporter 12);
Immunogens
A synthesized peptide derived from human MCT12, corresponding to a region within C-terminal amino acids.
Most highly expressed in kidney, followed by retina, lung, heart and testis. Very weakly expressed in brain and liver. Also detected in lens.
- Q6ZSM3 MOT12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSGSHWTANSSKIITWLLEQPGKEEKRKTMAKVNRARSTSPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYSFLLMSDFVVLAVSVLFMAYGCSPLFVYLVPYALSVGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVCYLFAVGMDGLCYLCLPMLQSLPLLVPFSCTFGYFDGAYVTLIPVVTTEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGRLVDTTGSYTAAFLLCGFSMIFSSVLLGFARLIKRMRKTQLQFIAKESDPKLQLWTNGSVAYSVARELDQKHGEPVATAVPGYSLT
Research Backgrounds
Proton-linked monocarboxylate transporter that mediates creatine transport across the plasma membrane.
Cell membrane>Multi-pass membrane protein.
Most highly expressed in kidney, followed by retina, lung, heart and testis. Very weakly expressed in brain and liver. Also detected in lens.
Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.