Phospho-CDK20 (Thr161) Antibody - #AF7033
Product: | Phospho-CDK20 (Thr161) Antibody |
Catalog: | AF7033 |
Description: | Rabbit polyclonal antibody to Phospho-CDK20 (Thr161) |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 31kDa; 39kD(Calculated). |
Uniprot: | Q8IZL9 |
RRID: | AB_2843473 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7033, RRID:AB_2843473.
Fold/Unfold
CAK kinase p42; CAK-kinase p42; CCRK; CDCH; CDK activating kinase p42; CDK-activating kinase p42; cdk20; CDK20_HUMAN; Cell cycle related kinase; Cell cycle-related kinase; Cell division protein kinase 20; Cyclin dependent protein kinase H; Cyclin kinase activating kinase p42; Cyclin-dependent kinase 20; Cyclin-dependent protein kinase H; Cyclin-kinase-activating kinase p42; p42; PNQALRE;
Immunogens
A synthesized peptide derived from human CDK20 around the phosphorylation site of Thr161.
- Q8IZL9 CDK20_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Required for high-level Shh responses in the developing neural tube. Together with TBC1D32, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in response to SHH signaling (By similarity). Involved in cell growth. Activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue 'Thr-160'.
Nucleus. Cytoplasm. Cell projection>Cilium.
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.