Phospho-FABP7 (Thr117) Antibody - #AF7034
Product: | Phospho-FABP7 (Thr117) Antibody |
Catalog: | AF7034 |
Description: | Rabbit polyclonal antibody to Phospho-FABP7 (Thr117) |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 15kDa; 15kD(Calculated). |
Uniprot: | O15540 |
RRID: | AB_2843474 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7034, RRID:AB_2843474.
Fold/Unfold
B FABP; B-FABP; BFABP; BLBP; Brain lipid binding protein; Brain lipid-binding protein; Brain-type fatty acid-binding protein; DKFZp547J2313; FABP 7; FABP7; FABP7_HUMAN; FABPB; Fatty Acid Binding Protein 7; Fatty acid binding protein 7 brain; Fatty acid binding protein brain; Fatty acid-binding protein 7; Fatty acid-binding protein, brain; Mammary derived growth inhibitor related; Mammary-derived growth inhibitor related; MRG; OTTHUMP00000017119;
Immunogens
A synthesized peptide derived from human FABP7 around the phosphorylation site of Thr117.
- O15540 FABP7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers (By similarity).
Cytoplasm.
Expressed in brain and other neural tissues.
Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Research Fields
· Organismal Systems > Endocrine system > PPAR signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.