OCT3 Antibody - #AF0226

Product: | OCT3 Antibody |
Catalog: | AF0226 |
Description: | Rabbit polyclonal antibody to OCT3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Rabbit, Dog |
Mol.Wt.: | 50kDa; 39kD(Calculated). |
Uniprot: | Q01860 |
RRID: | AB_2833401 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0226, RRID:AB_2833401.
Fold/Unfold
Octamer binding transcription factor 4; MGC22487; Oct 3; Oct 4; Oct-3; Oct-4; OCT3; Oct4; Octamer binding protein 3; Octamer binding protein 4; Octamer binding transcription factor 3; Octamer-binding protein 3; Octamer-binding protein 4; Octamer-binding transcription factor 3; OTF 3; OTF 4; OTF-3; OTF3; OTF4; PO5F1_HUMAN; POU class 5 homeobox 1; POU domain class 5 transcription factor 1; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; POU-type homeodomain-containing DNA-binding protein; POU5F1;
Immunogens
Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.
- Q01860 PO5F1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q01860 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S12 | Phosphorylation | Uniprot | |
T92 | Phosphorylation | Uniprot | |
S93 | Phosphorylation | Uniprot | |
S105 | Phosphorylation | Uniprot | |
S107 | Phosphorylation | Uniprot | |
S111 | Phosphorylation | P27361 (MAPK3) , P28482 (MAPK1) | Uniprot |
T116 | Phosphorylation | Uniprot | |
T118 | Phosphorylation | P28482 (MAPK1) | Uniprot |
K123 | Sumoylation | Uniprot | |
K140 | Methylation | Uniprot | |
K140 | Ubiquitination | Uniprot | |
K144 | Acetylation | Uniprot | |
K144 | Methylation | Uniprot | |
K151 | Acetylation | Uniprot | |
K151 | Methylation | Uniprot | |
K151 | Ubiquitination | Uniprot | |
K154 | Acetylation | Uniprot | |
K154 | Methylation | Uniprot | |
K154 | Ubiquitination | Uniprot | |
K156 | Acetylation | Uniprot | |
K156 | Methylation | Uniprot | |
K156 | Ubiquitination | Uniprot | |
T163 | Phosphorylation | Uniprot | |
K177 | Methylation | Uniprot | |
S180 | Phosphorylation | Uniprot | |
R186 | Methylation | Uniprot | |
S193 | Phosphorylation | Uniprot | |
K195 | Acetylation | Uniprot | |
K195 | Methylation | Uniprot | |
K195 | Ubiquitination | Uniprot | |
K199 | Acetylation | Uniprot | |
K199 | Methylation | Uniprot | |
K206 | Methylation | Uniprot | |
K206 | Ubiquitination | Uniprot | |
T235 | Phosphorylation | P31751 (AKT2) , P31749 (AKT1) , Q9Y243 (AKT3) | Uniprot |
S236 | Phosphorylation | Uniprot | |
S288 | Phosphorylation | P11309 (PIM1) , P17612 (PRKACA) | Uniprot |
S289 | Phosphorylation | P11309 (PIM1) , P17612 (PRKACA) | Uniprot |
S290 | Phosphorylation | Uniprot | |
Y292 | Phosphorylation | Uniprot | |
T352 | Phosphorylation | Uniprot | |
S355 | Phosphorylation | P28482 (MAPK1) | Uniprot |
S359 | Phosphorylation | Uniprot |
Research Backgrounds
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
Sumoylation enhances the protein stability, DNA binding and transactivation activity. Sumoylation is required for enhanced YES1 expression.
Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination by WWP2 leading to proteasomal degradation.
ERK1/2-mediated phosphorylation at Ser-111 promotes nuclear exclusion and proteasomal degradation. Phosphorylation at Thr-235 and Ser-236 decrease DNA-binding and alters ability to activate transcription.
Cytoplasm. Nucleus.
Note: Expressed in a diffuse and slightly punctuate pattern. Colocalizes with MAPK8 and MAPK9 in the nucleus.
Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.
Interacts with PKM. Interacts with WWP2. Interacts with UBE2I and ZSCAN10 (By similarity). Interacts with PCGF1. Interacts with ESRRB; recruits ESRRB near the POU5F1-SOX2 element in the NANOG proximal promoter; the interaction is DNA independent (By similarity). Interacts with ZNF322 (By similarity). Interacts with MAPK8 and MAPK9; the interaction allows MAPK8 and MAPK9 to phosphorylate POU5F1 on Ser-355 (By similarity). Interacts (when phosphorylated on Ser-355) with FBXW8 (By similarity). Interacts with FBXW4 (By similarity). Interacts with SOX2 and SOX15; binds synergistically with either SOX2 or SOX15 to DNA (By similarity).
The POU-specific domain mediates interaction with PKM.
Belongs to the POU transcription factor family. Class-5 subfamily.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
References
Application: WB Species: porcine Sample: pMSCs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.