Annexin IV Antibody - #AF7586
| Product: | Annexin IV Antibody |
| Catalog: | AF7586 |
| Description: | Rabbit polyclonal antibody to Annexin IV |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 36kDa; 36kD(Calculated). |
| Uniprot: | P09525 |
| RRID: | AB_2843950 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7586, RRID:AB_2843950.
Fold/Unfold
35 beta calcimedin; 35-beta calcimedin; AIV; Annexin 4; Annexin A4; Annexin IV (placental anticoagulant protein II); Annexin IV; Annexin IV placental anticoagulant protein II; Annexin-4; AnnexinA4; AnnexinIV; ANX 4; ANX A4; ANX4; ANXA 4; ANXA4; ANXA4 protein; ANXA4_HUMAN; Carbohydrate binding protein P33/P41; Carbohydrate-binding protein p33/p41; Chromobindin 4; Chromobindin-4; Chromobindin4; DKFZp686H02120; Endonexin I; EndonexinI; Lipocortin IV; LipocortinIV; MGC75105; OTTHUMP00000160052; OTTHUMP00000202207; P32.5; P33/41; PAP II; PAP-II; PAPII; PIG 28; PIG28; Placental anticoagulant protein II; PP4 X; PP4-X; PP4X; Proliferation inducing gene 28; Proliferation inducing protein 28; Protein II; Xanx-4; ZAP 36; ZAP36;
Immunogens
A synthesized peptide derived from human Annexin IV, corresponding to a region within the internal amino acids.
- P09525 ANXA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
A pair of annexin repeats may form one binding site for calcium and phospholipid.
Belongs to the annexin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.