LAT Antibody - #AF7625
| Product: | LAT Antibody |
| Catalog: | AF7625 |
| Description: | Rabbit polyclonal antibody to LAT |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 28kDa; 28kD(Calculated). |
| Uniprot: | O43561 |
| RRID: | AB_2843989 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7625, RRID:AB_2843989.
Fold/Unfold
36 kDa phospho tyrosine adapter protein; 36 kDa phospho-tyrosine adapter protein; 36 kDa phospho-tyrosine adaptor protein; LAT 1; lat; LAT_HUMAN; LAT1; Linker for activation of T cells; Linker for activation of T cells family member 1; linker for activation of T cells, transmembrane adaptor; Linker for activation of T-cells family member 1; p36 38; p36-38; pp36;
Immunogens
A synthesized peptide derived from human LAT, corresponding to a region within N-terminal amino acids.
Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).
- O43561 LAT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Research Backgrounds
Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.
Phosphorylated on tyrosines by ZAP70 upon TCR activation, or by SYK upon other immunoreceptor activation; which leads to the recruitment of multiple signaling molecules. Is one of the most prominently tyrosine-phosphorylated proteins detected following TCR engagement. May be dephosphorylated by PTPRJ. Phosphorylated by ITK leading to the recruitment of VAV1 to LAT-containing complexes.
Palmitoylation of Cys-26 and Cys-29 is required for raft targeting and efficient phosphorylation.
Cell membrane>Single-pass type III membrane protein.
Note: Present in lipid rafts.
Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).
Research Fields
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway. (View pathway)
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.