Product: YB1 Antibody
Catalog: AF7832
Description: Rabbit polyclonal antibody to YB1
Application: WB
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 50kDa(Observed); 36kD(Calculated).
Uniprot: P67809
RRID: AB_2844196

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(89%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
YB1 Antibody detects endogenous levels of total YB1.
RRID:
AB_2844196
Cite Format: Affinity Biosciences Cat# AF7832, RRID:AB_2844196.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BP 8; CBF-A; CCAAT binding transcription factor I subunit A; CCAAT-binding transcription factor I subunit A; CSDA2; CSDB; DBPB; DNA binding protein B; DNA-binding protein B; EFI-A; Enhancer factor I subunit A; MDR NF1; MGC104858; MGC110976; MGC117250; NSEP 1; NSEP1; Nuclease sensitive element binding protein 1; Nuclease-sensitive element-binding protein 1; p50; Q15905; Y-box binding protein 1; Y-box transcription factor; Y-box-binding protein 1; YB 1; YB-1; YBOX1_HUMAN; YBX 1; ybx1;

Immunogens

Immunogen:

A synthesized peptide derived from human YB1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Zebrafish
89
Xenopus
78
Chicken
67
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

DNA- and RNA-binding protein involved in various processes, such as translational repression, RNA stabilization, mRNA splicing, DNA repair and transcription regulation. Predominantly acts as a RNA-binding protein: binds preferentially to the 5'-[CU]CUGCG-3' RNA motif and specifically recognizes mRNA transcripts modified by C5-methylcytosine (m5C). Promotes mRNA stabilization: acts by binding to m5C-containing mRNAs and recruiting the mRNA stability maintainer ELAVL1, thereby preventing mRNA decay. Component of the CRD-mediated complex that promotes MYC mRNA stability. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors (By similarity). Plays a key role in RNA composition of extracellular exosomes by defining the sorting of small non-coding RNAs, such as tRNAs, Y RNAs, Vault RNAs and miRNAs. Probably sorts RNAs in exosomes by recognizing and binding C5-methylcytosine (m5C)-containing RNAs. Acts as a key effector of epidermal progenitors by preventing epidermal progenitor senescence: acts by regulating the translation of a senescence-associated subset of cytokine mRNAs, possibly by binding to m5C-containing mRNAs. Also involved in pre-mRNA alternative splicing regulation: binds to splice sites in pre-mRNA and regulates splice site selection. Also able to bind DNA: regulates transcription of the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as MDR1 and HLA class II genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA, suggesting a role in DNA repair. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation.

PTMs:

Ubiquitinated by RBBP6; leading to a decrease of YBX1 transcactivational ability.

In the absence of phosphorylation the protein is retained in the cytoplasm.

Cleaved by a 20S proteasomal protease in response to agents that damage DNA. Cleavage takes place in the absence of ubiquitination and ATP. The resulting N-terminal fragment accumulates in the nucleus (By similarity).

Subcellular Location:

Cytoplasm. Nucleus. Cytoplasmic granule. Secreted. Secreted>Extracellular exosome.
Note: Predominantly cytoplasmic in proliferating cells (PubMed:12604611). Cytotoxic stress and DNA damage enhance translocation to the nucleus (PubMed:14718551). Localized in cytoplasmic mRNP granules containing untranslated mRNAs (PubMed:25229427). Shuttles between nucleus and cytoplasm (PubMed:25229427). Localized with DDX1, MBNL1 and TIAL1 in stress granules upon stress (PubMed:18335541). Secreted by mesangial and monocytic cells after inflammatory challenges (PubMed:19483673).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

In the CSD domain, Trp-65 specifically recognizes C5-methylcytosine (m5C) modification through its indole ring.

Belongs to the YBX1 family.

References

1). Target deubiquitinase OTUB1 as a therapeatic strategy for BLCA via β-catenin/necroptosis signal pathway. International journal of biological sciences, 2024 (PubMed: 39113709) [IF=8.2]

Application: WB    Species: Mouse    Sample:

Figure 7. OTUB1 is involved in cisplatin resistance of BLCA through β-catenin stabilization. A. Cell survival assay was determined in T24 control cell and T24 cisplatin-resistance cell. B. The changes in cell morphology between the T24 control cell and the T24 cisplatin-resistance cell. C. Relative expression of several chemoresistance markers (including MDR1, BCRP and YB-1) in T24 control cell and T24 cisplatin-resistance cell with or without cisplatin treatment. D. Relative expression of OTUB1 in T24 control cell and T24 cisplatin-resistance cell with or without cisplatin treatment. E. Relative expression of OTUB1, necroptosis-related markers (such as RIPK3, MLKL and P-MLKL), β-catenin and downstream proteins (including AXIN-2, C-myc, cyclin D1 and TCF1) in T24 cisplatin-resistance cells treated with gradient cisplatin concentration. F. Immunoprecipitation assay showed the relationship between OTUB1 and β-catenin in T24 cisplatin-resistance cells. G. Immunoprecipitation assay showed that gradient cisplatin concentration promotes the interaction between OTUB1 and β-catenin, and restrains the ubiquitination of β-catenin. H. Relative expression of OTUB1, necroptosis-related markers (such as RIPK3, MLKL and P-MLKL), β-catenin and downstream targets following elevated OTUB1, β-catenin with or without XAV-939 treatment in T24 cisplatin-resistance cell (control, OTUB1, OTUB1/XAV-939, β-catenin). I. Cell survival assay was determined in T24 cisplatin-resistance cells following overexpressed OTUB1 with or without 10uM XAV-939 (or knockdown OTUB1 with or without overexpressed β-catenin). J. Knockdown OTUB1 restrains the growth in T24 cisplatin-resistance mice bladder tumor in vivo.

2). Unraveling the molecular mechanisms of Fufangduzhong formula in alleviating high-fat diet-induced non-alcoholic fatty liver disease in mice. Frontiers in pharmacology, 2025 (PubMed: 40144651) [IF=5.6]

3). Long non-coding RNA PRSS23-AS1 as ceRNA promotes breast cancer progression by regulating EMT via miR-3176 /YBX1 axis. Cancer gene therapy, 2025 (PubMed: 40707772) [IF=4.8]

4). Y-box binding protein 1 augments sorafenib resistance via the PI3K/Akt signaling pathway in hepatocellular carcinoma. World Journal of Gastroenterology, 2021 (PubMed: 34366628) [IF=4.3]

Application: WB    Species: Human    Sample: liver tissues

Figure 1 Increased expression of Y-box binding protein 1 in the liver tissues of hepatocellular carcinoma patients and cell lines. A: The protein expression levels of Y-box binding protein 1 (YB-1) in 6 pairs of hepatocellular carcinoma (HCC) liver tissues and their corresponding nontumor tissues were detected by Western blot analysis. Paraffin-embedded sections of liver tissues were stained with hematoxylin-eosin (HE) (B), and immunohistochemistry staining of YB-1 (C) was performed in the 2 groups; D: Western blot analysis showed YB-1 protein expression in one normal (N) liver cell line and four HCC cell lines. YB-1 protein levels (normalized to glyceraldehyde-3-phosphate dehydrogenase (GAPDH)) were measured by scanning densitometry. aP < 0.05, bP < 0.001 vs the indicated groups. T: Tumor.

Application: IHC    Species: Human    Sample: liver tissues

Figure 1 Increased expression of Y-box binding protein 1 in the liver tissues of hepatocellular carcinoma patients and cell lines. A: The protein expression levels of Y-box binding protein 1 (YB-1) in 6 pairs of hepatocellular carcinoma (HCC) liver tissues and their corresponding nontumor tissues were detected by Western blot analysis. Paraffin-embedded sections of liver tissues were stained with hematoxylin-eosin (HE) (B), and immunohistochemistry staining of YB-1 (C) was performed in the 2 groups; D: Western blot analysis showed YB-1 protein expression in one normal (N) liver cell line and four HCC cell lines. YB-1 protein levels (normalized to glyceraldehyde-3-phosphate dehydrogenase (GAPDH)) were measured by scanning densitometry. aP < 0.05, bP < 0.001 vs the indicated groups. T: Tumor.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.