Product: P2X7 Antibody
Catalog: AF4626
Description: Rabbit polyclonal antibody to P2X7
Application: WB
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Dog
Mol.Wt.: 78kDa; 69kD(Calculated).
Uniprot: Q99572
RRID: AB_2844573

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(90%), Bovine(89%), Horse(100%), Sheep(89%), Dog(90%)
Clonality:
Polyclonal
Specificity:
P2X7 Antibody detects endogenous levels of total P2X7.
RRID:
AB_2844573
Cite Format: Affinity Biosciences Cat# AF4626, RRID:AB_2844573.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ATP receptor; P2rx7; P2RX7_HUMAN; P2X purinoceptor 7; P2X7; P2Z receptor; Purinergic receptor; purinergic receptor P2X, ligand gated ion channel, 7;

Immunogens

Immunogen:

A synthesized peptide derived from human P2X7, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q99572 P2RX7_HUMAN:

Widely expressed with highest levels in brain and immune tissues.

Sequence:
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Pig
90
Dog
90
Bovine
89
Sheep
89
Rabbit
70
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Receptor for ATP that acts as a ligand-gated ion channel. Responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Could function in both fast synaptic transmission and the ATP-mediated lysis of antigen-presenting cells. In the absence of its natural ligand, ATP, functions as a scavenger receptor in the recognition and engulfment of apoptotic cells.

PTMs:

Phosphorylation results in its inactivation.

ADP-ribosylation at Arg-125 is necessary and sufficient to activate P2RX7 and gate the channel.

Palmitoylation of several cysteines in the C-terminal cytoplasmic tail is required for efficient localization to cell surface.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed with highest levels in brain and immune tissues.

Family&Domains:

Belongs to the P2X receptor family.

Research Fields

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

References

1). Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration. Advanced Materials, 2024 (PubMed: 38295393) [IF=27.4]

2). Effect of Bufalin-PLGA Microspheres in the Alleviation of Neuropathic Pain via the CCI Model. Frontiers in Pharmacology, 2022 (PubMed: 35770074) [IF=5.6]

Application: WB    Species: Rat    Sample:

FIGURE 8 Bufalin-PLGA MS suppressed the protein expression of TRPV1 and P2X7 in CCI rats. (A) SDS-PAGE bands of TRPV1 and P2X7 protein in the DRG of different group rats. (B) Expression levels of TRPV1 protein in the DRG of different group rats. (C) Expression level of P2X7 protein in the DRG of different group rats. Data are expressed in the form of mean ± SEM, n = 3. ###p < 0.001 compared to the control group, *p < 0.05, **p < 0.01, and ***p < 0.001 compared to the CCI group.

Application: IF/ICC    Species: Rat    Sample:

FIGURE 9 Expressions of TRPV1 and P2X7 were visualized and quantified via immunofluorescence staining. (A) Immunofluorescence detection of TRPV1 protein in the DRG; green and blue staining represent TRPV1 and DAPI, respectively. (B) Immunofluorescence detection of P2X7 protein in the DRG; green and blue staining represent P2X7 and DAPI, respectively. Data is expressed in the form of mean ± SEM, n = 3. ###p < 0.001 compared to the control group, *p < 0.05, **p < 0.01, and ***p < 0.001 compared to the CCI group. (Scale bar = 20 µm).

3). Electroacupuncture Protects Against Cerebral Ischemia-Reperfusion Injury: Reducing Inflammatory Response and Cell Pyroptosis by Inhibiting P2X7/NLRP3/GSDMD Pathway. Neuropsychiatric disease and treatment, 2024 (PubMed: 39619494) [IF=2.5]

Application: IF/ICC    Species: Rat    Sample: brain cortex

Figure 4 Positive expression of P2X7R, NLRP3, and GSDMD in each group (immunofluorescence staining, × 400). (A) Representative immunofluorescence images of P2X7R in the brain cortex. (B) Representative immunofluorescence images of NLRP3 in the brain cortex. (C) Representative immunofluorescence images of GSDMD in the brain cortex. (D) P2X7R positive expression per site. (E) NLRP3 positive expression per site. (F) GSDMD positive expression per site. Sham: Vascular isolation surgery-no ligation; I/R: Modeled without any treatment; EA: Electroacupuncture-treated model rats. BBG: P2X7R inhibitor injection (50 mg/kg); MCC950: NLRP3 inhibitor injection (50 mg/kg). P2X7R: purinergic P2X receptor 7; GSDMD: gasdermin D; NLRP3: NOD-like receptor protein 3. Data are presented as mean ± standard error of the mean (n = 3). Compared to the Sham group, **P

Application: WB    Species: Rat    Sample: brain cortex

Figure 5 Protein and mRNA expression of pyroptosis-related proteins. (A) Representative images of protein bands of ASC, Caspase-1, P2X7R, NLRP3, and GSDMD. B-F: ASC (B), Caspase-1 (C), P2X7R (D), NLRP3 (E), and GSDMD (F) quantitative analysis showing the protein levels. G-I: P2X7R (G), NLRP3 (H), and GSDMD (I) quantitative analysis showing the mRNA levels. Sham: Vascular isolation surgery-no ligation; I/R: Modeled without any treatment; EA: Electroacupuncture-treated model rats. BBG: P2X7R inhibitor injection (50 mg/kg); MCC950: NLRP3 inhibitor injection (50 mg/kg). P2X7R: purinergic P2X receptor 7; GSDMD: gasdermin D; NLRP3: NOD-like receptor protein 3. Data are presented as mean ± standard error of mean (n = 3). Compared to the Sham group, **P

4). Pinocembrin ameliorates depressive-like behaviors by regulating P2X7/TRL4 receptors expression in mouse hippocampus. Behavioural pharmacology, 2022 (PubMed: 35621136) [IF=1.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.