Product: SMCR7L/MID51 Antibody
Catalog: DF12019
Description: Rabbit polyclonal antibody to SMCR7L/MID51
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 48-51 kDa(Observed); 51kD(Calculated).
Uniprot: Q9NQG6
RRID: AB_2844824

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Zebrafish(%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
SMCR7L/MID51 Antibody detects endogenous levels of total SMCR7L/MID51.
RRID:
AB_2844824
Cite Format: Affinity Biosciences Cat# DF12019, RRID:AB_2844824.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

dJ1104E15.3; HSU79252; Hypothetical protein LOC54471; MID51; MIEF1; mitochondrial dynamic protein MID51; mitochondrial dynamic protein of 51 kDa; mitochondrial dynamics protein MID51; mitochondrial dynamics protein of 51 kDa; mitochondrial elongation factor 1; SMC7L_HUMAN; SMCR7-like protein; Smcr7l; Smith Magenis syndrome chromosome region candidate gene 7 protein like; Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like; Smith-Magenis syndrome chromosome region, candidate 7-like;

Immunogens

Immunogen:

A synthesized peptide derived from human SMCR7L/MID51, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q9NQG6 MID51_HUMAN:

Expression is relatively high in heart, skeletal muscle, pancreas and kidney.

Sequence:
MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Chicken
100
Rabbit
100
Zebrafish
92
Xenopus
83
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Mitochondrial outer membrane protein which regulates mitochondrial fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity and DNM1L oligomerization. Binds ADP and can also bind GDP, although with lower affinity. Does not bind CDP, UDP, ATP, AMP or GTP. Inhibits DNM1L GTPase activity in the absence of bound ADP. Requires ADP to stimulate DNM1L GTPase activity and the assembly of DNM1L into long, oligomeric tubules with a spiral pattern, as opposed to the ring-like DNM1L oligomers observed in the absence of bound ADP. Does not require ADP for its function in recruiting DNM1L.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expression is relatively high in heart, skeletal muscle, pancreas and kidney.

Family&Domains:

Belongs to the SMCR7 family.

References

1). Valproic acid regulates MIEF1 through MST2-HIPPO to suppress breast cancer growth. Life sciences, 2022 (PubMed: 36126724) [IF=5.2]

2). MicroRNA-27b alleviates septic cardiomyopathy by targeting the Mff/MAVS axis. Frontiers in cellular and infection microbiology, 2025 (PubMed: 40766842) [IF=4.6]

Application: WB    Species: Mouse    Sample:

Figure 4 miR-27b reduces mitochondrial fission by targeting Mff. (A, B), RT-qPCR detection of miR-27b and Mff mRNA expression levels in each cell group. (C–F), Quantitative analysis of Mff, Drp1, Mid49, and Mid51 protein expression levels by Western blot. (G), Representative Western blot bands for each group. (H), Dual-luciferase reporter assay verifying the targeting relationship between miR-27b and Mff; upper panel shows wild-type (WT) and mutant-type (MT) Mff 3’UTR sequence diagrams. (I), Transmission electron microscopy observation of mitochondrial ultrastructure in each cell group, scale bar=500 nm. (J), Confocal laser scanning microscopy observation of MFF expression and subcellular localization in each cell group, scale bar=50 μm. #P

3). Interval and continuous exercise overcome memory deficits related to β-Amyloid accumulation through modulating mitochondrial dynamics. BEHAVIOURAL BRAIN RESEARCH, 2019 (PubMed: 31445975) [IF=2.6]

Application: WB    Species: mouse    Sample: hippocampus

Fig. 5.| HIIT and MICT ameliorated mitochondrial fission and fusion in the hippocampus of APP/PS1 transgenic mice. The levels of DRP1 (a), FIS1 (b), MFF (c),MID49 (d), MID51 (e), MFN1 (f), MFN2 (g) and OPA1 (h) were detected in the hippocampus.

4). M1 Microglia Induced Neuronal Injury on Ischemic Stroke via Mitochondrial Crosstalk between Microglia and Neurons. Oxidative Medicine and Cellular Longevity, 2022 (PubMed: 36478988)

Application: WB    Species: Mouse    Sample: M0-BV2 and M1-BV2 cells

Figure 3 Mitochondrial changes in activated microglia (M1). (a) Schematic diagram of intracellular mitochondrial fusion and fission process in microglia after OGD/R. (b) Western blot assay of mitochondrial fusion protein (Opa1 and Mfn1), TOM20, and cytochrome c in mitochondria of M0 and M1 microglia (n = 3). Results are displayed in a form of mean ± SD; ∗P < 0.05, ∗∗P < 0.01, and ∗∗∗P < 0.001. (c) Western blotting findings of mitochondrial fission protein including MFF, Fis1, Mid49, and Mid51 in mitochondria of M0 and M1 microglia (n = 3). Data presented are mean ± SD; ∗∗P < 0.01 and ∗∗∗P < 0.001. (d) Mitochondrial function in M1 microglia and M0 microglia was investigated by determining ATP (n = 3), mitochondria membrane potential (n = 3), and ROS (n = 3). The relative ratio of intracellular ATP was determined by calculating the ratio of level of ATP in M0-BV2 and M1-BV2 cells to level of ATP in M0-BV2 cells. Results are displayed in a form of mean ± SD. ∗∗P < 0.01 and ∗∗∗P < 0.001. (e) Morphology of intracellular mitochondria in BV2 cells visualized under TEM, scale bar: 1.0 μm.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.