SRX1 Antibody - #DF12028

Product: | SRX1 Antibody |
Catalog: | DF12028 |
Description: | Rabbit polyclonal antibody to SRX1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 14 kDa; 14kD(Calculated). |
Uniprot: | Q9BYN0 |
RRID: | AB_2844833 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12028, RRID:AB_2844833.
Fold/Unfold
C20orf1392; Chromosome 20 open reading frame 139; dJ850E9.2; Npn3; Npn31; SRX1; SRXN 1; Sulfiredoxin 1; Sulfiredoxin 1 homolog (S. cerevisiae); Sulfiredoxin 1 homolog; YKL086W;
Immunogens
- Q9BYN0 SRXN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BYN0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
R4 | Methylation | Uniprot | |
T8 | Phosphorylation | Uniprot | |
R11 | Methylation | Uniprot | |
R16 | Methylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
R37 | Methylation | Uniprot | |
S123 | Phosphorylation | Uniprot |
Research Backgrounds
Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. Does not act on PRDX5 or PRDX6. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase.
Cytoplasm.
Widely expressed with highest levels in kidney, lung, spleen and thymus.
Belongs to the sulfiredoxin family.
References
Application: WB Species: Human Sample:
Application: IHC Species: Human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.