CISD1 Antibody - #DF12038
| Product: | CISD1 Antibody |
| Catalog: | DF12038 |
| Description: | Rabbit polyclonal antibody to CISD1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat, Zebrafish |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 14-17 kDa; 12kD(Calculated). |
| Uniprot: | Q9NZ45 |
| RRID: | AB_2844843 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12038, RRID:AB_2844843.
Fold/Unfold
AU043990; AW743335; C10orf70; CDGSH iron sulfur domain 1; CDGSH iron-sulfur domain-containing protein 1; CISD 1; CISD1; CISD1_HUMAN; D10Ertd214e; MDS029; MGC14684; MitoNEET; RGD1309529; ZCD1; Zinc finger CDGSH type domain 1;
Immunogens
A synthesized peptide derived from human CISD1, corresponding to a region within the internal amino acids.
- Q9NZ45 CISD1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays a key role in regulating maximal capacity for electron transport and oxidative phosphorylation (By similarity). May be involved in Fe-S cluster shuttling and/or in redox reactions.
Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.
Mitochondrion outer membrane>Single-pass type III membrane protein.
Expression is reduced in cells derived from cystic fibrosis patients.
Belongs to the CISD protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.