PLDN Antibody - #DF12041
Product: | PLDN Antibody |
Catalog: | DF12041 |
Description: | Rabbit polyclonal antibody to PLDN |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 25 kDa; 20kD(Calculated). |
Uniprot: | Q9UL45 |
RRID: | AB_2844846 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12041, RRID:AB_2844846.
Fold/Unfold
Bloc1s6; iogenesis of lysosome-related organelles complex 1 subunit 6; PA; Pallid (mouse) homolog; PALLID; Pallid protein; Pallid protein homolog; Pallidin; Pallidin homolog (mouse); PLDN; PLDN_HUMAN; Syntaxin 13 binding protein; Syntaxin 13-interacting protein;
Immunogens
A synthesized peptide derived from human PLDN, corresponding to a region within C-terminal amino acids.
- Q9UL45 BL1S6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. May play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process.
Phosphorylated.
Cytoplasm. Membrane>Peripheral membrane protein.
Note: It can exist as a soluble protein as well as a peripheral membrane protein (PubMed:12019270).
Widely expressed.
Belongs to the BLOC1S6 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.