SMCR7/MID49 Antibody - #DF12044
| Product: | SMCR7/MID49 Antibody |
| Catalog: | DF12044 |
| Description: | Rabbit polyclonal antibody to SMCR7/MID49 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Horse |
| Mol.Wt.: | 49 kDa; 49kD(Calculated). |
| Uniprot: | Q96C03 |
| RRID: | AB_2844849 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12044, RRID:AB_2844849.
Fold/Unfold
MGC23130; MID49; MID49_HUMAN; MIEF2; Mitochondrial dynamic protein MID49; Mitochondrial dynamic protein of 49 kDa; Mitochondrial dynamics protein MID49; Mitochondrial dynamics protein of 49 kDa; Mitochondrial elongation factor 2; Smith Magenis syndrome chromosome region candidate 7; Smith-Magenis syndrome chromosomal region candidate gene 7 protein;
Immunogens
A synthesized peptide derived from human SMCR7/MID49, corresponding to a region within the internal amino acids.
Expressed in all tissues tested with highest expression in heart and skeletal muscle.
- Q96C03 MID49_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPLVLEPGLWSLVPGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLSSRVLLELLRKALAASVNWPAIGSLLGCLIRPSMASEELLLEVQHERLELTVAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDAGTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCHFNPSVNLFSSLREEEIDDIGYALYSGLQEPEGLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mitochondrial outer membrane protein which regulates mitochondrial organization. It is required for mitochondrial fission and promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity.
Mitochondrion outer membrane>Single-pass membrane protein.
Note: Colocalizes with DNM1L at mitochondrial membrane. Forms foci and rings around mitochondria.
Expressed in all tissues tested with highest expression in heart and skeletal muscle.
Belongs to the MID49/MID51 family.
References
Application: WB Species: Mouse Sample:
Application: WB Species: Mouse Sample: Heart tissue
Application: WB Species: mouse Sample: hippocampus
Application: WB Species: Mouse Sample: M0-BV2 and M1-BV2 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.