Product: NBR1 Antibody
Catalog: DF12049
Description: Rabbit polyclonal antibody to NBR1
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 140 kDa(Observed); 107kD(Calculated).
Uniprot: Q14596
RRID: AB_2844854

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat, Monkey
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
NBR1 Antibody detects endogenous levels of total NBR1.
RRID:
AB_2844854
Cite Format: Affinity Biosciences Cat# DF12049, RRID:AB_2844854.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

1A1 3B; 1A13B; B box protein; Cell migration-inducing gene 19 protein; KIAA0049; M17S2; Membrane component chromosome 17 surface marker 2; Membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); MIG 19; MIG19; Migration inducing protein 19; NBR 1; Nbr1; NBR1, autophagy cargo receptor; NBR1_HUMAN; Neighbor of BRCA1 gene 1; Neighbor of BRCA1 gene 1 protein; Next to BRCA1 gene 1 protein; Ovarian carcinoma antigen CA125; Protein 1A1-3B;

Immunogens

Immunogen:

A synthesized peptide derived from human NBR1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPVTIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets.

Subcellular Location:

Cytoplasm. Cytoplasmic vesicle>Autophagosome. Lysosome. Cytoplasm>Myofibril>Sarcomere>M line.
Note: In cardiac muscles localizes to the sarcomeric M line (By similarity). Is targeted to lysosomes for degradation (PubMed:19250911).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

The PB1 domain mediates interaction with SQSTM1.

References

1). Bradykinin postconditioning protects rat hippocampal neurons after restoration of spontaneous circulation following cardiac arrest via activation of the AMPK/mTOR signaling pathway. Neural Regeneration Research, 2022 (PubMed: 35259843) [IF=5.9]

Application: IHC    Species: Rat    Sample: brain tissue

Figure 4 | Effect of bradykinin postconditioning on the immunopositivity of AMPK/ mTOR signaling pathway, autophagy-related proteins, and brain injury marker in rats with restoration of spontaneous circulation, as detected by immunohistochemistry.

2). MARCH6 suppresses Tembusu virus replication by targeting viral NS5 protein for TOLLIP-mediated selective autophagic degradation. Journal of virology, 2025 (PubMed: 40511919) [IF=4.0]

Application: WB    Species: duck    Sample:

Fig 6 MARCH6 recruits TOLLIP as an autophagy cargo receptor for NS5 degradation. (A and B) Lysates of DEFs co-transfected with the indicated Flag-tagged cargo receptors and HA-MARCH6 (A) or HA-NS5 (B) were subjected to co-IP assays with an anti-Flag antibody, followed by Western blotting analysis. (C–E) Lysates from DEFs co-transfected with plasmids encoding HA-NS5 and Flag-TOLLIP (C), Flag-OPTN (D), or Flag-NBR1 (E), together with or without MYC-MARCH6, and treated with Baf A1 (10 µM), were subjected to co-IP assays using an anti-Flag antibody, followed by immunoblot analysis with the indicated antibodies. (F–H) Lysates from DEFs co-transfected with specific siRNA targeting MARCH6 and plasmids encoding Flag-NS5 and HA-TOLLIP (F), HA-OPTN (G), or HA-NBR1 (H) were subjected to co-IP assays using an anti-Flag antibody, followed by immunoblot analysis with the indicated antibodies. (I–K) Immunoblot analysis of lysates of DEFs co-transfected with HA-NS5 and shTOLLIP (I), shOPTN (J), or shNBR1 (K), together with or without Flag-MARCH6 for 24 h. (L and M) DEFs were transfected with shNegative or shTOLLIP, along with Flag-MARCH6 or an empty vector for 24 h and then infected with TMUV at an MOI of 0.1. E protein expression was analyzed by Western blotting (L), and viral titers were quantified using the TCID50 assay (M). (M) Data are presented as mean values ± standard error of the mean of three independent experiments (Student’s t-test; **, P < 0.01) ns, not significant.

3). Bradykinin postconditioning protects rat hippocampal neurons after restoration of spontaneous circulation following cardiac arrest via activation of the AMPK/mTOR signaling pathway. Neural regeneration research, 2022 (PubMed: 35259843)

Application: IHC    Species: Rat    Sample:

Figure 4 | Effect of bradykinin postconditioning on the immunopositivity of AMPK/ mTOR signaling pathway, autophagy-related proteins, and brain injury marker in rats with restoration of spontaneous circulation, as detected by immunohistochemistry. Compared with the Sham group, p-mTOR and p62 immunopositivity in the ROSC group was significantly decreased, S100β, p-AMPK, and LC3 immunopositivity was significantly increased, and NBR1 immunopositivity remained unchanged. Compared with the ROSC group, p-mTOR, p62, and S100β immunopositivity in the BK group was significantly decreased, while p-AMPK, NBR1, and LC3 immunopositivity was significantly increased. Compared with the BK group, LC3, p-AMPK, and NBR1 immunopositivity in the CP+BK group was significantly decreased, whereas S100β, p62, and p-mTOR immunopositivity was significantly increased; LC3, p-AMPK, and NBR1 immunopositivity in the Ra+BK group was significantly increased, while S100β, p62, and p-mTOR immunopositivity was significantly decreased. Scale bars: 50 μm. All data are presented as the mean ± SD (n = 8). *P < 0.05, **P < 0.01, vs. Sham group; #P < 0.05, ##P < 0.01, vs. ROSC group; †P < 0.05, ††P < 0.01, vs. BK group (one-way analysis of variance followed by Tukey’s post hoc test). BK: Bradykinin; CP: compound C; IOD: integrated optical density; LC3: microtubule-associated protein 1 light chain 3; NBR1: neighbor of breast cancer 1 gene; p-AMPK: phosphorylated adenosine-monophosphate activated protein kinase; p-mTOR: p-mechanistic target of rapamycin; Ra: rapamycin; ROSC: restoration of spontaneous circulation; S100β: S100 calcium-binding protein B; Sham: sham operation.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.