RAB27B Antibody - #DF12060

Product: | RAB27B Antibody |
Catalog: | DF12060 |
Description: | Rabbit polyclonal antibody to RAB27B |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 25-30 kDa; 25kD(Calculated). |
Uniprot: | O00194 |
RRID: | AB_2844865 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12060, RRID:AB_2844865.
Fold/Unfold
C25KG; Rab27b; RAB27B member RAS oncogene family; RAS associated protein RAB27B; Ras related protein Rab 27b; Ras related protein Rab27b; Ras-related protein Rab-27B; RB27B_HUMAN; Small GTP binding protein rab27b;
Immunogens
- O00194 RB27B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00194 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T2 | Phosphorylation | Uniprot | |
Y6 | Phosphorylation | Uniprot | |
T75 | Phosphorylation | Uniprot | |
S83 | Phosphorylation | Uniprot | |
K154 | Ubiquitination | Uniprot | |
S203 | Phosphorylation | Uniprot |
Research Backgrounds
Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion. Plays a role in NTRK2/TRKB axonal anterograde transport by facilitating the association of NTRK2/TRKB with KLC1. May be involved in targeting uroplakins to urothelial apical membranes (By similarity).
Membrane>Lipid-anchor. Late endosome.
Expressed primarily in testis.
Interacts with SYTL2, SYTL4, MYRIP and MLPH. Interacts with RPH3A and RPH3A (By similarity). Interacts (GDP-bound form preferentially) with DENND10.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Organismal Systems > Digestive system > Pancreatic secretion.
References
Application: IHC Species: human Sample: non‑small cell lung cancer
Application: WB Species: human Sample: non‑small cell lung cancer
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.