REEP5 Antibody - #DF12062
| Product: | REEP5 Antibody |
| Catalog: | DF12062 |
| Description: | Rabbit polyclonal antibody to REEP5 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Zebrafish, Bovine, Dog |
| Mol.Wt.: | 21 kDa; 21kD(Calculated). |
| Uniprot: | Q00765 |
| RRID: | AB_2844867 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12062, RRID:AB_2844867.
Fold/Unfold
C5orf18; D5S346; Deleted in polyposis 1; DP1; Polyposis coli region hypothetical protein DP1; Polyposis locus protein 1; Protein TB2; Receptor accessory protein 5; Receptor expression enhancing protein 5; TB2; TB2 protein; YOP1;
Immunogens
- Q00765 REEP5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q00765 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K16 | Ubiquitination | Uniprot | |
| K25 | Ubiquitination | Uniprot | |
| K147 | Ubiquitination | Uniprot | |
| S154 | Phosphorylation | Uniprot | |
| K157 | Ubiquitination | Uniprot | |
| K162 | Acetylation | Uniprot | |
| K164 | Acetylation | Uniprot | |
| K164 | Ubiquitination | Uniprot | |
| K172 | Ubiquitination | Uniprot | |
| K176 | Ubiquitination | Uniprot | |
| T178 | Phosphorylation | Uniprot | |
| K186 | Ubiquitination | Uniprot | |
| S188 | Phosphorylation | Uniprot | |
| T189 | Phosphorylation | Uniprot |
Research Backgrounds
May promote functional cell surface expression of olfactory receptors.
Membrane>Multi-pass membrane protein. Endoplasmic reticulum.
Note: Localizes to endoplasmic reticulum tubular network.
Expressed in circumvallate papillae and testis.
Interacts with ATL1 (By similarity). Interacts with ATL2. Interacts with ZFYVE27.
Belongs to the DP1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.