GOLPH3 Antibody - #DF12099
| Product: | GOLPH3 Antibody |
| Catalog: | DF12099 |
| Description: | Rabbit polyclonal antibody to GOLPH3 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB, IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 34 kDa; 34kD(Calculated). |
| Uniprot: | Q9H4A6 |
| RRID: | AB_2844904 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12099, RRID:AB_2844904.
Fold/Unfold
Coat protein; Coat protein GPP34; FLJ90675; Golgi associated protein; Golgi peripheral membrane protein 1, 34 kDa; Golgi phosphoprotein 3 (coat protein); Golgi phosphoprotein 3; Golgi protein; GOLP3_HUMAN; Golph3; GOPP1; GPP34; MIDAS; Mitochondrial DNA absence factor;
Immunogens
A synthesized peptide derived from human GOLPH3, corresponding to a region within C-terminal amino acids.
Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers.
- Q9H4A6 GOLP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. May also bind to the coatomer to regulate Golgi membrane trafficking. May play a role in anterograde transport from the Golgi to the plasma membrane and regulate secretion. Has also been involved in the control of the localization of Golgi enzymes through interaction with their cytoplasmic part. May play an indirect role in cell migration. Has also been involved in the modulation of mTOR signaling. May also be involved in the regulation of mitochondrial lipids biosynthesis.
Phosphorylated.
Golgi apparatus>Golgi stack membrane>Peripheral membrane protein>Cytoplasmic side. Golgi apparatus>trans-Golgi network membrane>Peripheral membrane protein>Cytoplasmic side. Mitochondrion intermembrane space. Cell membrane. Endosome.
Note: Phosphatidylinositol 4-phosphate-binding and oligomerization participate in the recruitment onto Golgi membranes.
Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers.
Belongs to the GOLPH3/VPS74 family.
References
Application: IF/ICC Species: human Sample: Beas-2B cells
Application: WB Species: human Sample: Beas-2B cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.