Product: Coilin Antibody
Catalog: DF12149
Description: Rabbit polyclonal antibody to Coilin
Application: WB IHC
Cited expt.: IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 80 kDa; 63kD(Calculated).
Uniprot: P38432
RRID: AB_2844954

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Coilin Antibody detects endogenous levels of total Coilin.
RRID:
AB_2844954
Cite Format: Affinity Biosciences Cat# DF12149, RRID:AB_2844954.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CLN 80; CLN80; COIL; COIL_HUMAN; Coilin; Coilin p80; p80; P80 coilin;

Immunogens

Immunogen:

A synthesized peptide derived from human Coilin, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P38432 COIL_HUMAN:

Found in all the cell types examined.

Sequence:
MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

Research Backgrounds

Function:

Component of nuclear coiled bodies, also known as Cajal bodies or CBs, which are involved in the modification and assembly of nucleoplasmic snRNPs.

PTMs:

Symmetrical dimethylation of arginine residues within the RG repeat region enhances affinity for SMN, and thus localization of SMN complexes to CBs.

Phosphorylation during mitosis is associated with disassembly of CBs.

Subcellular Location:

Nucleus. Nucleus>Cajal body.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Found in all the cell types examined.

Family&Domains:

The atypical Tudor domain at the C-terminus contains two large unstructured loops, and does not bind methylated residues.

Belongs to the coilin family.

References

1). Predicting and Validating the Regulation of Podocyte Injury and Treatment of Diabetic Kidney Disease by Yinhuo Tang. Journal of visualized experiments : JoVE, 2025 (PubMed: 40622867) [IF=1.2]

Application: IHC    Species: Mouse    Sample:

Figure 2: Amelioration of the histopathological damage of kidneys in DKD mice. (A,B) Renal histology by H&E and PAS staining (scale bar = 20 µm); (C) Masson staining to observe the degree of renal fibrosis and (D) semi-quantitative analysis using ImageJ software; (E-G) Semiquantitative analysis of the relative expression levels of COI-I and α-SMA in renal tissues using IHC and ImageJ software (scale bar = 20 µm). Abbreviations: YHT = yinhuo Tang; DKD = diabetic kidney disease; H&E = Hematoxylin and Eosin stain; PAS = Periodic Acid-Schiff stain; COI-I = Collagen type I; α-SMA = α-smooth muscle actin; CON = control group; MOD = model group; POS = valsartan Positive control group; YH-L = low-dose group of the YHT; YH-M = middle-dose group of the YHT; YH-H = high-dose group of the YHT.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.