Product: Coilin Antibody
Catalog: DF12149
Description: Rabbit polyclonal antibody to Coilin
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 80 kDa; 63kD(Calculated).
Uniprot: P38432
RRID: AB_2844954

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Coilin Antibody detects endogenous levels of total Coilin.
RRID:
AB_2844954
Cite Format: Affinity Biosciences Cat# DF12149, RRID:AB_2844954.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CLN 80; CLN80; COIL; COIL_HUMAN; Coilin; Coilin p80; p80; P80 coilin;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P38432 COIL_HUMAN:

Found in all the cell types examined.

Sequence:
MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

PTMs - P38432 As Substrate

Site PTM Type Enzyme
T39 Phosphorylation
S43 Phosphorylation
S94 Phosphorylation
S105 Phosphorylation
T122 Phosphorylation
C126 S-Nitrosylation
Y128 Phosphorylation
S129 Phosphorylation
K151 Sumoylation
K151 Ubiquitination
K160 Ubiquitination
T169 Phosphorylation
T172 Phosphorylation
S184 Phosphorylation P24941 (CDK2) , Q86Y07 (VRK2) , Q99986 (VRK1)
S202 Phosphorylation
K204 Acetylation
K209 Sumoylation
K209 Ubiquitination
S217 Phosphorylation
S218 Phosphorylation
S226 Phosphorylation
S235 Phosphorylation
S240 Phosphorylation
S247 Phosphorylation
S256 Phosphorylation
S271 Phosphorylation
S272 Phosphorylation
K274 Ubiquitination
T277 Phosphorylation
K281 Ubiquitination
T286 Phosphorylation
T289 Phosphorylation
T290 Phosphorylation
K293 Acetylation
K293 Ubiquitination
S301 Phosphorylation
T303 Phosphorylation
S305 Phosphorylation
R350 Methylation
R352 Methylation
R393 Methylation
R397 Methylation
S403 Phosphorylation
K405 Acetylation
K405 Methylation
K405 Ubiquitination
R419 Methylation
S447 Phosphorylation
T448 Phosphorylation
T456 Phosphorylation
K459 Ubiquitination
Y461 Phosphorylation
S462 Phosphorylation
K476 Ubiquitination
S486 Phosphorylation
S487 Phosphorylation
Y488 Phosphorylation
S489 Phosphorylation
K496 Acetylation
K496 Ubiquitination
S502 Phosphorylation
K555 Ubiquitination
S566 Phosphorylation
S568 Phosphorylation
T570 Phosphorylation
S571 Phosphorylation
S572 Phosphorylation
T573 Phosphorylation

Research Backgrounds

Function:

Component of nuclear coiled bodies, also known as Cajal bodies or CBs, which are involved in the modification and assembly of nucleoplasmic snRNPs.

PTMs:

Symmetrical dimethylation of arginine residues within the RG repeat region enhances affinity for SMN, and thus localization of SMN complexes to CBs.

Phosphorylation during mitosis is associated with disassembly of CBs.

Subcellular Location:

Nucleus. Nucleus>Cajal body.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Found in all the cell types examined.

Subunit Structure:

Interacts with ANKS1B. Interacts with SMN1 (via Tudor domain). Interacts (via C-terminus) with AK6. Interacts with WRAP53/TCAB1. Interacts with HMBOX1. Interacts with PSME3; the interaction is inhibited by PSME3IP1.

Family&Domains:

The atypical Tudor domain at the C-terminus contains two large unstructured loops, and does not bind methylated residues.

Belongs to the coilin family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.