Coilin Antibody - #DF12149
Product: | Coilin Antibody |
Catalog: | DF12149 |
Description: | Rabbit polyclonal antibody to Coilin |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 80 kDa; 63kD(Calculated). |
Uniprot: | P38432 |
RRID: | AB_2844954 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12149, RRID:AB_2844954.
Fold/Unfold
CLN 80; CLN80; COIL; COIL_HUMAN; Coilin; Coilin p80; p80; P80 coilin;
Immunogens
- P38432 COIL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA
PTMs - P38432 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T39 | Phosphorylation | Uniprot | |
S43 | Phosphorylation | Uniprot | |
S94 | Phosphorylation | Uniprot | |
S105 | Phosphorylation | Uniprot | |
T122 | Phosphorylation | Uniprot | |
C126 | S-Nitrosylation | Uniprot | |
Y128 | Phosphorylation | Uniprot | |
S129 | Phosphorylation | Uniprot | |
K151 | Sumoylation | Uniprot | |
K151 | Ubiquitination | Uniprot | |
K160 | Ubiquitination | Uniprot | |
T169 | Phosphorylation | Uniprot | |
T172 | Phosphorylation | Uniprot | |
S184 | Phosphorylation | P24941 (CDK2) , Q86Y07 (VRK2) , Q99986 (VRK1) | Uniprot |
S202 | Phosphorylation | Uniprot | |
K204 | Acetylation | Uniprot | |
K209 | Sumoylation | Uniprot | |
K209 | Ubiquitination | Uniprot | |
S217 | Phosphorylation | Uniprot | |
S218 | Phosphorylation | Uniprot | |
S226 | Phosphorylation | Uniprot | |
S235 | Phosphorylation | Uniprot | |
S240 | Phosphorylation | Uniprot | |
S247 | Phosphorylation | Uniprot | |
S256 | Phosphorylation | Uniprot | |
S271 | Phosphorylation | Uniprot | |
S272 | Phosphorylation | Uniprot | |
K274 | Ubiquitination | Uniprot | |
T277 | Phosphorylation | Uniprot | |
K281 | Ubiquitination | Uniprot | |
T286 | Phosphorylation | Uniprot | |
T289 | Phosphorylation | Uniprot | |
T290 | Phosphorylation | Uniprot | |
K293 | Acetylation | Uniprot | |
K293 | Ubiquitination | Uniprot | |
S301 | Phosphorylation | Uniprot | |
T303 | Phosphorylation | Uniprot | |
S305 | Phosphorylation | Uniprot | |
R350 | Methylation | Uniprot | |
R352 | Methylation | Uniprot | |
R393 | Methylation | Uniprot | |
R397 | Methylation | Uniprot | |
S403 | Phosphorylation | Uniprot | |
K405 | Acetylation | Uniprot | |
K405 | Methylation | Uniprot | |
K405 | Ubiquitination | Uniprot | |
R419 | Methylation | Uniprot | |
S447 | Phosphorylation | Uniprot | |
T448 | Phosphorylation | Uniprot | |
T456 | Phosphorylation | Uniprot | |
K459 | Ubiquitination | Uniprot | |
Y461 | Phosphorylation | Uniprot | |
S462 | Phosphorylation | Uniprot | |
K476 | Ubiquitination | Uniprot | |
S486 | Phosphorylation | Uniprot | |
S487 | Phosphorylation | Uniprot | |
Y488 | Phosphorylation | Uniprot | |
S489 | Phosphorylation | Uniprot | |
K496 | Acetylation | Uniprot | |
K496 | Ubiquitination | Uniprot | |
S502 | Phosphorylation | Uniprot | |
K555 | Ubiquitination | Uniprot | |
S566 | Phosphorylation | Uniprot | |
S568 | Phosphorylation | Uniprot | |
T570 | Phosphorylation | Uniprot | |
S571 | Phosphorylation | Uniprot | |
S572 | Phosphorylation | Uniprot | |
T573 | Phosphorylation | Uniprot |
Research Backgrounds
Component of nuclear coiled bodies, also known as Cajal bodies or CBs, which are involved in the modification and assembly of nucleoplasmic snRNPs.
Symmetrical dimethylation of arginine residues within the RG repeat region enhances affinity for SMN, and thus localization of SMN complexes to CBs.
Phosphorylation during mitosis is associated with disassembly of CBs.
Nucleus. Nucleus>Cajal body.
Found in all the cell types examined.
Interacts with ANKS1B. Interacts with SMN1 (via Tudor domain). Interacts (via C-terminus) with AK6. Interacts with WRAP53/TCAB1. Interacts with HMBOX1. Interacts with PSME3; the interaction is inhibited by PSME3IP1.
The atypical Tudor domain at the C-terminus contains two large unstructured loops, and does not bind methylated residues.
Belongs to the coilin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.