TIA1 Antibody - #DF12176
| Product: | TIA1 Antibody |
| Catalog: | DF12176 |
| Description: | Rabbit polyclonal antibody to TIA1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 40 kDa; 43kD(Calculated). |
| Uniprot: | P31483 |
| RRID: | AB_2844981 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12176, RRID:AB_2844981.
Fold/Unfold
Cytotoxic granule associated RNA binding protein 1; Cytotoxic granule associated RNA binding protein; mTIA-1; Nucleolysin TIA 1 isoform p40; Nucleolysin TIA-1 isoform p40; Nucleolysin TIA1 isoform p40; p40 TIA 1; p40-TIA-1 (containing p15-TIA-1); p40-TIA-1; RNA binding protein TIA 1; RNA binding protein TIA1; RNA-binding protein TIA-1; T-cell-restricted intracellular antigen-1; TIA 1; TIA 1 cytotoxic granule associated RNA binding protein; Tia; TIA-1; TIA1; TIA1 cytotoxic granule associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein like 1; TIA1 protein; TIA1_HUMAN; TIAL1; TIAR; WDM;
Immunogens
- P31483 TIA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P31483 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| Y48 | Phosphorylation | Uniprot | |
| K77 | Ubiquitination | Uniprot | |
| T83 | Phosphorylation | Uniprot | |
| S86 | Phosphorylation | Uniprot | |
| K88 | Ubiquitination | Uniprot | |
| K89 | Ubiquitination | Uniprot | |
| T99 | Phosphorylation | Uniprot | |
| S102 | Phosphorylation | Uniprot | |
| R131 | Methylation | Uniprot | |
| Y149 | Phosphorylation | Uniprot | |
| S209 | Phosphorylation | Uniprot | |
| S210 | Phosphorylation | Uniprot | |
| S235 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in alternative pre-RNA splicing and regulation of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs). Possesses nucleolytic activity against cytotoxic lymphocyte target cells. May be involved in apoptosis.
Cytoplasm>Stress granule. Nucleus.
Note: Accumulates in cytoplasmic stress granules (SG) following cellular damage.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.