AP1M1 Antibody - #DF12188
| Product: | AP1M1 Antibody |
| Catalog: | DF12188 |
| Description: | Rabbit polyclonal antibody to AP1M1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 49 kDa; 49kD(Calculated). |
| Uniprot: | Q9BXS5 |
| RRID: | AB_2844993 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12188, RRID:AB_2844993.
Fold/Unfold
Adaptor protein complex AP-1 mu-1 subunit; Adaptor-related protein complex 1 mu-1 subunit; AP-1 complex subunit mu-1; AP-mu chain family member mu1A; Ap1m1; AP1M1_HUMAN; AP47; CLAPM2; Clathrin adaptor protein AP47; Clathrin assembly protein complex 1 medium chain 1; Clathrin assembly protein complex 1 medium chain; Clathrin assembly protein complex AP1 mu subunit; Clathrin coat assembly protein AP47; Clathrin coat-associated protein AP47; CLTNM; Golgi adaptor AP 1 47 kDa protein; Golgi adaptor HA1/AP1 adaptin mu-1 subunit; HA1 47 kDa subunit; MU 1A; Mu-adaptin 1; Mu1A-adaptin;
Immunogens
A synthesized peptide derived from human AP1M1, corresponding to a region within the internal amino acids.
- Q9BXS5 AP1M1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Phosphorylation of membrane-bound AP1M1/AP1M2 increases its affinity for sorting signals.
Golgi apparatus. Cytoplasmic vesicle>Clathrin-coated vesicle membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
Belongs to the adaptor complexes medium subunit family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.