DNAJB3 Antibody - #DF12268
| Product: | DNAJB3 Antibody |
| Catalog: | DF12268 |
| Description: | Rabbit polyclonal antibody to DNAJB3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 28-30 kDa; 17kD(Calculated). |
| Uniprot: | Q8WWF6 |
| RRID: | AB_2845073 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12268, RRID:AB_2845073.
Fold/Unfold
DnaJ (Hsp40) homolog subfamily B member 3; DnaJ homolog subfamily B member 3; Dnajb3; DNJB3_HUMAN; HCG3 gene; HCG3 protein; Hypothetical protein LOC414061; MGC26879; Putative uncharacterized protein tmp_locus_21; Tmp_locus_21;
Immunogens
A synthesized peptide derived from human DNAJB3, corresponding to a region within the internal amino acids.
- Q8WWF6 DNJB3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ
Research Backgrounds
May operate as a co-chaperone of the male germ cell- and haploid stage-specific Hsp70 proteins.
Expressed in sperm (at protein level).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.