Osteocalcin Antibody - #DF12303
(164)
(74)
| Product: | Osteocalcin Antibody |
| Catalog: | DF12303 |
| Description: | Rabbit polyclonal antibody to Osteocalcin |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB, IHC, IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 11 kDa; 11kD(Calculated). |
| Uniprot: | P02818 |
| RRID: | AB_2845108 |
Related Downloads
Protocols
Product Info
Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Dog(100%), Chicken(91%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Osteocalcin Antibody detects endogenous levels of total Osteocalcin.
RRID:
AB_2845108
Cite Format: Affinity Biosciences Cat# DF12303, RRID:AB_2845108.
Cite Format: Affinity Biosciences Cat# DF12303, RRID:AB_2845108.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:
Fold/Unfold
BGLAP; BGP; Bone gamma carboxyglutamate (gla) protein; Bone gamma carboxyglutamate gla protein osteocalcin; Bone gamma carboxyglutamate protein; Bone Gla protein; Gamma carboxyglutamic acid containing protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; OSTCN_HUMAN; Osteocalcin; OTTHUMP00000016586; PMF1;
Immunogens
Immunogen:
A synthesized peptide derived from human Osteocalcin, corresponding to a region within the internal amino acids.
Uniprot:
Gene(ID):
Sequence:
- P02818 OSTCN_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Predictions
Predictions:
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
91
Rabbit
64
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Function:
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
PTMs:
Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
Subcellular Location:
Secreted.
Family&Domains:
Belongs to the osteocalcin/matrix Gla protein family.
References
1). Polyphenol-mediated redox-active hydrogel with H2S gaseous-bioelectric coupling for periodontal bone healing in diabetes. Nature communications, 2024
(PubMed: 39433776)
[IF=16.6]
Application: IF/ICC Species: Rat Sample:
Fig. 7: Immunofluorescence staining of defect areas. a Immunofluorescence staining of CD90 at 7 days after operation in defect area in various groups and quantification analysis (mean ± SEM, n = 6 independent biological samples, one-way ANOVA). Immunofluorescence staining of angiopoiesis-related protein CD31 (b) and α-SMA (c) at 7 days after operation in defect area and quantification analysis (mean ± SEM, n = 6 independent biological samples, one-way ANOVA). Immunofluorescence staining of osteogenesis-related protein RUNX2 (d) and OCN (e) at 4 weeks after operation in defect area and quantification analysis (mean ± SEM, n = 6 independent biological samples, one-way ANOVA).
2). Long-lasting renewable antibacterial porous polymeric coatings enable titanium biomaterials to prevent and treat peri-implant infection. Nature Communications, 2021
(PubMed: 34083518)
[IF=16.6]
Application: WB Species: Human Sample: MC3T3-E1 preosteoblasts
Fig. 5 Biocompatibility assessments. a CCK-8 assay about the proliferation of MC3T3-E1 preosteoblasts cultured on Ti-OH and Ti-PAA-NCl after cells
were cultured for 1, 3 and 7 days (n = 3; P = 0.673, 0.639 and 0.145 for 1, 3 and 7 days compared with Ti-OH, respectively; Student’s t test). b Morphology
of MC3T3-E1 preosteoblasts cultured on Ti-OH and Ti-PAA-NCl for 1 day (green for F-actin, blue for cell nucleus, scale bar = 20 μm). c ALP activity of
MC3T3-E1 preosteoblasts cultured on Ti-OH and Ti-PAA-NCl for 7 and 14 days (n = 3; P = 0.132 and 0.954 for 7 and 14 days compared with Ti-OH;
Student’s t test). d Alizarin Red S staining of MC3T3-E1 preosteoblasts cultured on Ti-OH and Ti-PAA-NCl for 21 days (red for calcium nodules, scale bar
= 1 mm) and semi-quantitative measurement of calcium content (n = 3; P = 0.147 compared with Ti-OH; Student’s t test). e Western blot results of
osteogenic-related proteins (OCN, OPN and RUNX2) expressed in MC3T3-E1 preosteoblasts cultured on Ti-OH and Ti-PAA-NCl for 3, 7 and 14 days after
osteogenic induction. f RT-qPCR results of expression levels of osteogenic-related genes (OCN, OPN and RUNX2) in MC3T3-E1 preosteoblasts cultured on
Ti-OH and Ti-PAA-NCl for 3, 7 and 14 days after osteogenic induction (n = 3; P > 0.05 for all time points of these three genes between groups; Student’s t
test). g In vivo biocompatibility. HE staining and CD68 immunofluorescent staining of tissues around Ti-OH and Ti-PAA-NCl embedded in the backs of
nude mice for 4 weeks (fluorescent green for CD68, fluorescent blue for cell nucleus, white scale bars in HE images = 100 μm, black scale bars in HE
images = 25 μm, scale bars in CD68 immunofluorescent images = 100 μm). All error bars = s.d.
3). Mechanically heterogeneous hydrogel with cell-programmed network restructuring promotes tissue regeneration by mechano-epigenetic modulation. Nature communications, 2026
(PubMed: 41617717)
[IF=16.6]
4). Antibacterial Peptides-Produced Cell Hydrogel Eliminates Intracellular Pathogens and Remodels Immune Microenvironment for Osteomyelitis Therapy. ACS nano, 2025
(PubMed: 40336314)
[IF=15.8]
5). BMSC-NFMC Model for Vascular Regulation and Interface Integration in Osteochondral Regeneration. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2025
(PubMed: 40548626)
[IF=15.1]
Application: IHC Species: Mouse Sample:
Figure 5 Histological examination of BMSC-NFMC after subcutaneous implantation for 4 and 8 weeks. A) HE staining, Masson's trichrome staining, OCN staining, SO/FG staining, and COL 2 immunohistochemical staining of BMSC-NFMC subcutaneous implantation for 4 weeks. B) Corresponding histological examination images after 8 weeks. The red boxes in the figure represent the hybridized tissue regions of the samples, while the blue boxes represent the integrated osteochondral interface regions. Abbreviations: HE, hematoxylin and eosin; OCN, Osteocalcin; SO/FG, Safranin-O/Fast Green; COL 2, Type II collagen.
6). Mechanism of Piezo1 regulating chondrocyte mitochondrial function and promoting fracture healing through β-catenin/LARS2 signaling pathway. Bone research, 2025
(PubMed: 40993116)
[IF=14.3]
Application: WB Species: Mouse Sample:
Fig. 1 Knockout of the Piezo1 gene in chondrocytes inhibits their transdifferentiation into osteoblasts. a qPCR was used to detect changes in the expression of Piezo1 and osteogenic markers Opn (Spp1) and Runx2 in each group after osteogenic induction culture, n = 3. b–e WB was used to detect changes in the expression of Piezo1 and osteogenic markers OPN and RUNX2 in each group after osteogenic induction culture and statistical analysis, n = 3. f, g ALP and alizarin red staining were used to detect ALP levels after 7 days of osteogenic induction culture and the expression of calcium nodules after 21 days of induction culture, scale = 200 μm. h, i Statistical analysis of ALP and Alizarin Red stain were performed, n = 3. j–l qPCR was used to detect changes in the expression of Col1α, Alp, and Ocn in each group, n = 3. m–p WB was used to detect changes in the expression of Col1α, ALP, and OCN in each group and statistical analysis, n = 3. q Schematic diagram of fluorescence colorimetric principle of gene mice R26-tdTomato. r Lineage tracing was used to detect the transdifferentiation forms of chondrocytes during endochondral ossification and the role of Piezo1 in endochondral ossification during fracture healing, scale = 50 μm, n = 3. Cg: Cartilage tissue; Wo.B: Woven bone tissue. blue: nucleus; red: tdTOmato; green: Col1; golden (colocalization): osteoblasts derived from chondrocytes’ transdifferentiation. s The statistical analysis of osteoblasts derived from chondrocytes’ transdifferentiation.
7). Delivery of therapeutic miRNAs using nanoscale zeolitic imidazolate framework for accelerating vascularized bone regeneration. Chemical Engineering Journal, 2022
[IF=13.3]
8). pH‐Triggered Size‐Tunable Silver Nanoparticles: Targeted Aggregation for Effective Bacterial Infection Therapy. Small, 2022
(PubMed: 35499191)
[IF=13.0]
9). Fusion peptide engineered “statically-versatile” titanium implant simultaneously enhancing anti-infection, vascularization and osseointegration. Biomaterials, 2021
(PubMed: 33069134)
[IF=12.8]
10). Gold nanoparticles targeting the autophagy–lysosome system to combat the inflammation-compromised osteogenic potential of periodontal ligament stem cells: From mechanism to therapy. Biomaterials, 2022
(PubMed: 36030103)
[IF=12.8]
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.