TIMM17B Antibody - #DF12331
| Product: | TIMM17B Antibody |
| Catalog: | DF12331 |
| Description: | Rabbit polyclonal antibody to TIMM17B |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 17-20 kDa; 18kD(Calculated). |
| Uniprot: | O60830 |
| RRID: | AB_2845136 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12331, RRID:AB_2845136.
Fold/Unfold
DXS9822; Inner mitochondrial membrane preprotein translocase; JM3; Mitochondrial import inner membrane translocase subunit Tim17-B; TI17B_HUMAN; Tim17b; TIMM17B; Translocase of inner mitochondrial membrane 17 homolog B (yeast);
Immunogens
Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.
- O60830 TI17B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O60830 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K35 | Ubiquitination | Uniprot | |
| R49 | Methylation | Uniprot | |
| R56 | Methylation | Uniprot | |
| K86 | Ubiquitination | Uniprot | |
| T134 | Phosphorylation | Uniprot |
Research Backgrounds
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Forms one disulfide bond.
Mitochondrion inner membrane>Multi-pass membrane protein.
Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.
Component of the TIM23 complex at least composed of TIMM23, TIMM17 (TIMM17A or TIMM17B) and TIMM50. The complex interacts with the TIMM44 component of the PAM complex and with DNAJC15.
Belongs to the Tim17/Tim22/Tim23 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.