C14orf166 Antibody - #DF12359
| Product: | C14orf166 Antibody |
| Catalog: | DF12359 |
| Description: | Rabbit polyclonal antibody to C14orf166 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Zebrafish, Xenopus |
| Mol.Wt.: | 28 kDa; 28kD(Calculated). |
| Uniprot: | Q9Y224 |
| RRID: | AB_2845164 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12359, RRID:AB_2845164.
Fold/Unfold
C14orf166; CGI 99; CGI-99; CGI99; Chromosome 14 open reading frame 166; CLE; CLE7; CN166_HUMAN; Homeobox prox 1; LCRP369; RLL motif containing 1; RLLM1; UPF0568 protein C14orf166;
Immunogens
A synthesized peptide derived from human C14orf166, corresponding to a region within N-terminal amino acids.
Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney. Overexpressed in many brain tumors.
- Q9Y224 RTRAF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport.
(Microbial infection) In case of infection by influenza virus A (IVA), is involved in viral replication.
Nucleus. Cytoplasm>Cytosol. Cytoplasm>Perinuclear region. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Note: May localize at the centrosome during mitosis (PubMed:15147888). Shuttles between the cytosol and the nucleus: enters into the nucleus in case of active transcription while it accumulates in cytosol when transcription level is low (PubMed:24608264).
Nucleus. Cytoplasm.
Note: (Microbial infection) Following influenza A virus (IAV) infection, included in influenza A virions via its association with packaged viral ribonucleoproteins (vRNP) in the nucleus and cytoplasm (PubMed:21900157, PubMed:26864902).
Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney. Overexpressed in many brain tumors.
Belongs to the RTRAF family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.