CHCHD4 Antibody - #DF12364
Product: | CHCHD4 Antibody |
Catalog: | DF12364 |
Description: | Rabbit polyclonal antibody to CHCHD4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 22 kDa; 16kD(Calculated). |
Uniprot: | Q8N4Q1 |
RRID: | AB_2845169 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12364, RRID:AB_2845169.
Fold/Unfold
CHCHD4; Coiled coil helix coiled coil helix domain containing 4; Coiled coil helix coiled coil helix domain containing protein 4; Coiled-coil-helix-coiled-coil-helix domain-containing protein 4; FLJ31709; MIA40_HUMAN; Mitochondrial intermembrane space import and assembly 40 homolog; Mitochondrial intermembrane space import and assembly protein 40; TIMM40; Translocase of inner mitochondrial membrane 40 homolog;
Immunogens
- Q8N4Q1 MIA40_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8N4Q1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K100 | Ubiquitination | Uniprot | |
Y101 | Phosphorylation | Uniprot | |
S142 | Phosphorylation | Uniprot |
Research Backgrounds
Central component of a redox-sensitive mitochondrial intermembrane space import machinery which is required for the biogenesis of respiratory chain complexes. Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17, COX19, MICU1 and COA7. Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Required for the import of COA7 in the IMS. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS. Reduced CHCHD4/MIA40 is then reoxidized by GFER/ERV1 via a disulfide relay system. Mediates formation of disulfide bond in MICU1 in the IMS, promoting formation of the MICU1-MICU2 heterodimer that regulates mitochondrial calcium uptake.
Forms intrachain disulfide bridges, but exists in different redox states.
Mitochondrion intermembrane space.
Expressed in all tissues tested, suggesting an ubiquitous expression.
Monomer. Can form homooligomers. Interacts with GFER and forms transient disulfide bonds with GFER. Interacts with MICU1. Interacts with COX19 forming transient intermolecular disulfide bridges. Interacts with COA7 through transient intermolecular disulfide bonds. Interacts with AIFM1; the interaction increases in presence of NADH.
The CHCH domain contains a conserved twin Cys-X(9)-Cys motif which is required for import and stability of MIA40 in mitochondria.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.