CYPC Antibody - #DF12379
| Product: | CYPC Antibody |
| Catalog: | DF12379 |
| Description: | Rabbit polyclonal antibody to CYPC |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | P45877 |
| RRID: | AB_2845184 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12379, RRID:AB_2845184.
Fold/Unfold
Cyclophilin C; CYPC; MGC3673; Parvulin; Peptidyl prolyl cis trans isomerase C; Peptidyl-prolyl cis-trans isomerase C; Peptidylprolyl isomerase C (cyclophilin C); peptidylprolyl isomerase C; PPIase C; ppiC; PPIC_HUMAN; Rotamase C;
Immunogens
Expressed in kidney, skeletal muscle, pancreas, heart, lung, liver and to a lower extent in brain.
- P45877 PPIC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P45877 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S35 | Phosphorylation | Uniprot | |
| R45 | Methylation | Uniprot | |
| K65 | Ubiquitination | Uniprot | |
| K78 | Ubiquitination | Uniprot | |
| K123 | Methylation | Uniprot | |
| K123 | Ubiquitination | Uniprot |
Research Backgrounds
PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding.
Cytoplasm.
Expressed in kidney, skeletal muscle, pancreas, heart, lung, liver and to a lower extent in brain.
Belongs to the cyclophilin-type PPIase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.