DIO1 Antibody - #DF12382
| Product: | DIO1 Antibody |
| Catalog: | DF12382 |
| Description: | Rabbit polyclonal antibody to DIO1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Sheep, Rabbit, Dog |
| Mol.Wt.: | 13 kDa, 29 kDa; 29kD(Calculated). |
| Uniprot: | P49895 |
| RRID: | AB_2845187 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12382, RRID:AB_2845187.
Fold/Unfold
5DI; deiodinase iodothyronine type I; DIO1; DIOI; IOD1_HUMAN; thyroxine deiodinase type I (selenoprotein); TXDI1; Type 1 DI; type I 5' deiodinase; Type I iodothyronine deiodinase; Type-I 5''-deiodinase;
Immunogens
A synthesized peptide derived from human DIO1, corresponding to a region within C-terminal amino acids.
- P49895 IOD1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCTUPSFMFKFDQFKRLIEDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDRLQAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYIIQEGRILYKGKSGPWNYNPEEVRAVLEKLHS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine) and of T3 into T2 (3,3'-diiodothyronine). Plays a role in providing a source of plasma T3 by deiodination of T4 in peripheral tissues such as liver and kidney.
Endoplasmic reticulum membrane>Single-pass membrane protein.
Belongs to the iodothyronine deiodinase family.
Research Fields
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.