FBXO22 Antibody - #DF12399
| Product: | FBXO22 Antibody |
| Catalog: | DF12399 |
| Description: | Rabbit polyclonal antibody to FBXO22 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Bovine, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 45 kDa; 45kD(Calculated). |
| Uniprot: | Q8NEZ5 |
| RRID: | AB_2845204 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12399, RRID:AB_2845204.
Fold/Unfold
0610033L19Rik; 1600016C16Rik; F box only protein 22; F box protein 22; F box protein FBX22p44; F-box only protein 22; F-box protein FBX22p44; FBX22; FBX22_HUMAN; FBXO 22; FBXO22; FIST domain containing 1; FISTC1; FLJ13986; MGC124731; MGC31799;
Immunogens
- Q8NEZ5 FBX22_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVLRTHRSVTWISAGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8NEZ5 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| K40 | Acetylation | Uniprot | |
| K40 | Ubiquitination | Uniprot | |
| Y104 | Phosphorylation | Uniprot | |
| S128 | Phosphorylation | Uniprot | |
| K137 | Ubiquitination | Uniprot | |
| K194 | Acetylation | Uniprot | |
| K194 | Ubiquitination | Uniprot | |
| K300 | Ubiquitination | Uniprot | |
| K337 | Ubiquitination | Uniprot |
Research Backgrounds
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Promotes the proteasome-dependent degradation of key sarcomeric proteins, such as alpha-actinin (ACTN2) and filamin-C (FLNC), essential for maintenance of normal contractile function.
Cytoplasm>Myofibril>Sarcomere>Z line.
Predominantly expressed in liver, also enriched in cardiac muscle.
Directly interacts with SKP1 and CUL1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.