GREM2 Antibody - #DF12407

Product: | GREM2 Antibody |
Catalog: | DF12407 |
Description: | Rabbit polyclonal antibody to GREM2 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Horse, Rabbit, Dog, Chicken |
Mol.Wt.: | 19 kDa; 19kD(Calculated). |
Uniprot: | Q9H772 |
RRID: | AB_2845212 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12407, RRID:AB_2845212.
Fold/Unfold
BMP antagonist 2; CKTSF1B2; Cysteine knot superfamily 1; Cysteine knot superfamily 1 BMP antagonist 2; DAN domain family member 3; DAND 3; DAND3; GREM 2; Grem2; GREM2_HUMAN; Gremlin 2; Gremlin 2 cysteine knot superfamily homolog; Gremlin-2; Gremlin2; PRDC; Protein related to DAN and cerberus;
Immunogens
- Q9H772 GREM2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H772 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S56 | Phosphorylation | Uniprot |
Research Backgrounds
Cytokine that inhibits the activity of BMP2 and BMP4 in a dose-dependent manner, and thereby modulates signaling by BMP family members. Contributes to the regulation of embryonic morphogenesis via BMP family members. Antagonizes BMP4-induced suppression of progesterone production in granulosa cells.
N-glycosylated.
Secreted.
Homodimer. Interacts with BMP2, BMP4 and BMP7, but has lower affinity for BMP7 than for BMP2 and BMP4. Binds heparin; this impairs the interaction with BMP2.
Belongs to the DAN family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.