OBFC2A Antibody - #DF12433
| Product: | OBFC2A Antibody |
| Catalog: | DF12433 |
| Description: | Rabbit polyclonal antibody to OBFC2A |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | Q96AH0 |
| RRID: | AB_2845238 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12433, RRID:AB_2845238.
Fold/Unfold
FLJ13624; FLJ22833; hSSB2; MGC111163; Nabp1; Nucleic acid-binding protein 1; OBFC2A; Oligonucleotide/oligosaccharide binding fold containing 2A; Oligonucleotide/oligosaccharide binding fold containing protein 2A; Oligonucleotide/oligosaccharide-binding fold-containing protein 2A; Sensor of single strand DNA complex subunit B2; Sensor of single-strand DNA complex subunit B2; Sensor of ssDNA subunit B2; Single stranded DNA binding protein 2; Single-stranded DNA-binding protein 2; SOSB2_HUMAN; SOSS B2; SOSS complex subunit B2; SOSS-B2; SSB2;
Immunogens
A synthesized peptide derived from human OBFC2A, corresponding to a region within the internal amino acids.
- Q96AH0 SOSB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.
Nucleus.
Note: Localizes to nuclear foci following DNA damage.
Belongs to the SOSS-B family. SOSS-B2 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.