PPAN Antibody - #DF12457
Product: | PPAN Antibody |
Catalog: | DF12457 |
Description: | Rabbit polyclonal antibody to PPAN |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 55-58 kDa; 53kD(Calculated). |
Uniprot: | Q9NQ55 |
RRID: | AB_2845262 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12457, RRID:AB_2845262.
Fold/Unfold
Brix domain containing protein 3; Brix domain-containing protein 3; BXDC3; Homolog of S. cerevisiae SSF1; Peter pan homolog (Drosophila); Peter Pan homolog; PPAN; Second step splicing factor 1; SSF 1; SSF; Ssf-1; SSF1; SSF1_HUMAN; SSF2; Suppressor of sterile four 1; Suppressor of SWI4 1 homolog;
Immunogens
A synthesized peptide derived from human PPAN, corresponding to a region within C-terminal amino acids.
- Q9NQ55 SSF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA
Research Backgrounds
May have a role in cell growth.
Nucleus>Nucleolus.
Widely expressed.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.