PTP4A1/PRL1 Antibody - #DF12458
Product: | PTP4A1/PRL1 Antibody |
Catalog: | DF12458 |
Description: | Rabbit polyclonal antibody to PTP4A1/PRL1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 22 kDa; 20kD(Calculated). |
Uniprot: | Q93096 |
RRID: | AB_2845263 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12458, RRID:AB_2845263.
Fold/Unfold
HH 72; HH72; Hypothetical protein DKFZp779M0721; Phosphatase of regenerating liver 1; PRL 1; PRL-1; PRL1; Protein tyrosine phosphatase PTPCAAX1; Protein tyrosine phosphatase type IVA 1; Protein tyrosine phosphatase type IVA member 1; Protein-tyrosine phosphatase 4a1; Protein-tyrosine phosphatase of regenerating liver 1; Protein-tyrosine phosphatase, type 4A, 1; PTP(CAAXI); Ptp4a1; PTPCAAX1; TP4A1_HUMAN;
Immunogens
A synthesized peptide derived from human PTP4A1/PRL1, corresponding to a region within C-terminal amino acids.
Expressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines.
- Q93096 TP4A1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis.
Farnesylated. Farnesylation is required for membrane targeting. Unfarnesylated forms are shifted into the nucleus.
Cell membrane. Early endosome. Endoplasmic reticulum. Cytoplasm. Cytoplasm>Cytoskeleton>Spindle.
Note: And mitotic spindle.
Expressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines.
Belongs to the protein-tyrosine phosphatase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.