REEP2 Antibody - #DF12463
Product: | REEP2 Antibody |
Catalog: | DF12463 |
Description: | Rabbit polyclonal antibody to REEP2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 28 kDa; 28kD(Calculated). |
Uniprot: | Q9BRK0 |
RRID: | AB_2845268 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12463, RRID:AB_2845268.
Fold/Unfold
C5orf19; Chromosome 5 open reading frame 19; Receptor accessory protein 2; Receptor expression enhancing protein 2; Receptor expression-enhancing protein 2; REEP 2; REEP2; REEP2_HUMAN; SGC32445; SPG72;
Immunogens
Detected in brain, heart and skeletal muscle, and at low levels in placenta, kidney and pancreas (PubMed:11161817). Expressed in circumvallate papillae (PubMed:16720576).
- Q9BRK0 REEP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA
PTMs - Q9BRK0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S97 | Phosphorylation | Uniprot | |
K101 | Ubiquitination | Uniprot | |
T108 | Phosphorylation | Uniprot | |
K113 | Ubiquitination | Uniprot | |
K145 | Ubiquitination | Uniprot | |
S148 | Phosphorylation | Uniprot | |
S150 | Phosphorylation | Uniprot | |
S178 | Phosphorylation | Uniprot | |
S208 | Phosphorylation | Uniprot | |
K242 | Acetylation | Uniprot | |
K243 | Acetylation | Uniprot | |
K244 | Acetylation | Uniprot |
Research Backgrounds
Required for endoplasmic reticulum (ER) network formation, shaping and remodeling. May enhance the cell surface expression of odorant receptors (By similarity).
Membrane>Multi-pass membrane protein.
Detected in brain, heart and skeletal muscle, and at low levels in placenta, kidney and pancreas. Expressed in circumvallate papillae.
Interacts with odorant receptor proteins.
Belongs to the DP1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.