REEP6 Antibody - #DF12464
| Product: | REEP6 Antibody |
| Catalog: | DF12464 |
| Description: | Rabbit polyclonal antibody to REEP6 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 22 kDa; 23kD(Calculated). |
| Uniprot: | Q96HR9 |
| RRID: | AB_2845269 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12464, RRID:AB_2845269.
Fold/Unfold
0610011M24Rik; C19orf32; Deleted in polyposis 1 like 1; Dp1l1; FLJ25383; OTTMUSP00000020650; OTTMUSP00000020651; OTTMUSP00000020652; OTTMUSP00000021713; OTTMUSP00000021714; Polyposis locus protein 1 like 1; Polyposis locus protein 1-like 1; Receptor accessory protein 6; Receptor expression enhancing protein 6; Receptor expression-enhancing protein 6; REEP6; REEP6_HUMAN; TB2 protein like 1; TB2L1;
Immunogens
A synthesized peptide derived from human REEP6, corresponding to a region within C-terminal amino acids.
Expressed in circumvallate papillae and testis (PubMed:16720576). Expressed in the retina. Isoform 1 is predominantly present in mature optic cups. Isoform 1 expression is confined to the cell body and inner segment of developing rod photoreceptor cells (PubMed:27889058).
- Q96HR9 REEP6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVLQVLARSRAGITPVAVAGPSTPLEADLKPSQTPQPKDK
Research Backgrounds
Required for correct function and survival of retinal photoreceptors. Required for retinal development (By similarity). In rod photoreceptors, facilitates stability and/or trafficking of guanylate cyclases and is required to maintain endoplasmic reticulum and mitochondrial homeostasis (By similarity). May play a role in clathrin-coated intracellular vesicle trafficking of proteins from the endoplasmic reticulum to the retinal rod plasma membrane (By similarity).
Endoplasmic reticulum membrane>Multi-pass membrane protein. Cytoplasmic vesicle>Clathrin-coated vesicle membrane>Multi-pass membrane protein.
Expressed in circumvallate papillae and testis. Expressed in the retina. Isoform 1 is predominantly present in mature optic cups. Isoform 1 expression is confined to the cell body and inner segment of developing rod photoreceptor cells.
Belongs to the DP1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.