Product: REEP6 Antibody
Catalog: DF12464
Description: Rabbit polyclonal antibody to REEP6
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 22 kDa(Observed); 23kD(Calculated).
Uniprot: Q96HR9
RRID: AB_2845269

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
REEP6 Antibody detects endogenous levels of total REEP6.
RRID:
AB_2845269
Cite Format: Affinity Biosciences Cat# DF12464, RRID:AB_2845269.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

0610011M24Rik; C19orf32; Deleted in polyposis 1 like 1; Dp1l1; FLJ25383; OTTMUSP00000020650; OTTMUSP00000020651; OTTMUSP00000020652; OTTMUSP00000021713; OTTMUSP00000021714; Polyposis locus protein 1 like 1; Polyposis locus protein 1-like 1; Receptor accessory protein 6; Receptor expression enhancing protein 6; Receptor expression-enhancing protein 6; REEP6; REEP6_HUMAN; TB2 protein like 1; TB2L1;

Immunogens

Immunogen:

A synthesized peptide derived from human REEP6, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q96HR9 REEP6_HUMAN:

Expressed in circumvallate papillae and testis (PubMed:16720576). Expressed in the retina. Isoform 1 is predominantly present in mature optic cups. Isoform 1 expression is confined to the cell body and inner segment of developing rod photoreceptor cells (PubMed:27889058).

Sequence:
MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVLQVLARSRAGITPVAVAGPSTPLEADLKPSQTPQPKDK

Research Backgrounds

Function:

Required for correct function and survival of retinal photoreceptors. Required for retinal development (By similarity). In rod photoreceptors, facilitates stability and/or trafficking of guanylate cyclases and is required to maintain endoplasmic reticulum and mitochondrial homeostasis (By similarity). May play a role in clathrin-coated intracellular vesicle trafficking of proteins from the endoplasmic reticulum to the retinal rod plasma membrane (By similarity).

Subcellular Location:

Endoplasmic reticulum membrane>Multi-pass membrane protein. Cytoplasmic vesicle>Clathrin-coated vesicle membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in circumvallate papillae and testis. Expressed in the retina. Isoform 1 is predominantly present in mature optic cups. Isoform 1 expression is confined to the cell body and inner segment of developing rod photoreceptor cells.

Family&Domains:

Belongs to the DP1 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.