Cleaved-Caspase 1 (Asp296), p20 Antibody - #AF4005

(179)   (52)  
Product: Cleaved-Caspase 1 (Asp296), p20 Antibody
Catalog: AF4005
Description: Rabbit polyclonal antibody to Cleaved-Caspase 1 (Asp296), p20
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 20kD(p20), 35~50kD(precursor); 45kD(Calculated).
Uniprot: P29466
RRID: AB_2845463

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Cleaved-Caspase-1 (Asp296,p20) Antibody detects endogenous levels of fragment of activated Caspase-1 resulting from cleavage adjacent to Asp296.
RRID:
AB_2845463
Cite Format: Affinity Biosciences Cat# AF4005, RRID:AB_2845463.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CASP-1; CASP1; CASP1_HUMAN; Caspase 1; Caspase-1 subunit p10; ICE; IL-1 beta-converting enzyme; IL-1BC; IL1 beta converting enzyme; IL1B convertase; Interleukin 1 beta convertase; Interleukin 1B converting enzyme; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45;

Immunogens

Immunogen:

The antiserum was produced against synthesized peptide derived from human Caspase 1.

Uniprot:

P29466(CASP1_HUMAN) >>Visit HPA database.

Gene(ID):
CASP1(834)
Expression:
P29466 CASP1_HUMAN:

Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.

Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Research Backgrounds

Function:

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.

PTMs:

The two subunits are derived from the precursor sequence by an autocatalytic mechanism.

Subcellular Location:

Cytoplasm. Cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.

Family&Domains:

Belongs to the peptidase C14A family.

Research Fields

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

References

1). Cascade-Type Microglial Pyroptosis Inhibitors for Enhanced Treatment of Cerebral Ischemia-Reperfusion Injury. ACS nano, 2025 (PubMed: 40047143) [IF=15.8]
2). Mitoxantrone-Encapsulated ZIF-8 Enhances Chemo-Immunotherapy via Amplified Immunogenic Cell Death. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2025 (PubMed: 39950857) [IF=15.1]
3). Interorgan communication in neurogenic heterotopic ossification: the role of brain-derived extracellular vesicles. Bone research, 2024 (PubMed: 38383487) [IF=14.3]
4). Gut microbiota dysbiosis in hyperuricaemia promotes renal injury through the activation of NLRP3 inflammasome. Microbiome, 2024 (PubMed: 38907332) [IF=13.8]
5). Inhibition of macrophage inflammasome assembly and pyroptosis with GC-1 ameliorates acute lung injury. Theranostics, 2025 (PubMed: 39990234) [IF=12.4]
6). Arsenic induces hepatic insulin resistance via mtROS-NLRP3 inflammasome pathway. JOURNAL OF HAZARDOUS MATERIALS, 2020 (PubMed: 32544768) [IF=12.2]

Application: WB    Species: Human    Sample: HepG2 cells

Fig.3 NaAsO2 impairs insulin signaling via activation of NLRP3 inflammasome in HepG2 cells. HepG2 cells were pretreated with 1 μg/ml LPS for 4 hours, 5 μM MCC950, for 4 hours, and were then treated with 4 μM NaAsO2 for 24 hours. Cytosolic fractions were analyzed by Western blot analysis. GAPDH was used as an internal control. The efficiency of MCC950, and its effect on NLRP3, caspase-1 activation, IL-1β and IL- 18 production in NaAsO2-treated HepG2 cells (A-E). HepG2 cells were stimulated with 100 nM insulin for 10 min at the end of treatment. Cytosolic fractions were analyzed by Western blot analysis. GAPDH was used as an internal control. The efficiency of MCC950, and its effect on p-IRS (Ser 307)/IRS1 and p-AKT (Ser473)/AKT1 ratio in NaAsO2-treated HepG2 cells (F-H). Insulin‐ stimulated glucose uptake in HepG2 cells was measured using a glucose assay kit (I). Results are mean ± SEM (n = 3). *P < 0.05 compare with the LPS group. #P<0.05 compare with 4 μM NaAsO2 group.
7). Biosynthesis of Lysosomally Escaped Apoptotic Bodies Inhibits Inflammasome Synthesis in Macrophages. Research (Washington, D.C.), 2025 (PubMed: 39850366) [IF=11.0]
8). Force-induced Caspase-1-dependent pyroptosis regulates orthodontic tooth movement. International journal of oral science, 2024 (PubMed: 38221531) [IF=10.8]
9). Dimethyl fumarate ameliorates erectile dysfunction in bilateral cavernous nerve injury rats by inhibiting oxidative stress and NLRP3 inflammasome-mediated pyroptosis of nerve via activation of Nrf2/HO-1 signaling pathway. Redox biology, 2023 (PubMed: 37931471) [IF=10.7]
10). Hair follicle-MSC-derived small extracellular vesicles as a novel remedy for acute pancreatitis. JOURNAL OF CONTROLLED RELEASE, 2022 (PubMed: 36402231) [IF=10.5]
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.