Product: Neutrophil Elastase Antibody
Catalog: AF0010
Description: Rabbit polyclonal antibody to Neutrophil Elastase
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 29 kDa; 29kD(Calculated).
Uniprot: P08246
RRID: AB_2845469

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Neutrophil Elastase Antibody detects endogenous levels of total Neutrophil Elastase.
RRID:
AB_2845469
Cite Format: Affinity Biosciences Cat# AF0010, RRID:AB_2845469.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Bone marrow serine protease; ELA2; ELANE; Elastase 2; Elastase 2 neutrophil; Elastase neutrophil expressed; Elastase-2; ELNE_HUMAN; GE; Granulocyte derived elastase; HLE; HNE; Human leukocyte elastase; Leukocyte elastase; Medullasin; NE; Neutrophil elastase; PMN E; PMN elastase; Polymorphonuclear elastase; SCN1;

Immunogens

Immunogen:

A synthesized peptide derived from human Neutrophil Elastase, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P08246 ELNE_HUMAN:

Bone marrow cells. Neutrophil (PubMed:10947984).

Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Research Backgrounds

Function:

Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis. Capable of killing E.coli but not S.aureus in vitro; digests outer membrane protein A (ompA) in E.coli and K.pneumoniae.

Subcellular Location:

Cytoplasmic vesicle>Phagosome.
Note: Localized in phagolysosomes following ingestion of E.coli by neutrophils.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Bone marrow cells. Neutrophil.

Family&Domains:

Belongs to the peptidase S1 family. Elastase subfamily.

Research Fields

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Immune diseases > Systemic lupus erythematosus.

References

1). Silicate-based therapy for inflammatory dilated cardiomyopathy by inhibiting the vicious cycle of immune inflammation via FOXO signaling. Science advances, 2025 (PubMed: 40203118) [IF=11.7]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 5. Effects of CS ion solution on modulation of the formation of NETs when FOXO3 was inhibited. (A) Western blot analysis demonstrating the activation of FOXO3 by CS in NETs. (B to D) Quantitative analysis of p-FOXO3 and t-FOXO3 protein expression levels as well as p-FOXO3/t-FOXO3 ratio based on Western blot. (E) The NET markers, including MPO-DNA, NE-DNA, cfDNA, and IL-1β, were measured in the medium after using CS ion solution and siFOXO3 by ELISA. (F) NETs treated with CS ion solution and siFOXO3 were stained with MPO (red), NE (green), and DAPI for visualization. Scale bars, 20 μm. n = 6, ###P < 0.001 versus control; *P < 0.05, **P < 0.01, ***P < 0.001 versus NETs; &P < 0.05, &&P < 0.01 versus NETs + CS + siFOXO3 (control: neutrophils not initiating NET differentiation; PMA: neutrophils initiating NET differentiation; PMA + CS: neutrophils initiating NET differentiation cultured with CS solution; PMA + siFOXO3: neutrophils initiating NET differentiation cultured with siFOXO3; PMA + CS + siFOXO3: neutrophils initiating NET differentiation cultured with CS ion solution and siFOXO3). The positive expression of NE or MPO and net structure DNA indicates that the neutrophils have differentiated into NETs.

2). TRIM30a coordinates neutrophil-macrophage crosstalk to resolve inflammation and drive osseointegration via suppressing NETosis/cGAS-STING axis. Materials today. Bio, 2025 (PubMed: 41560844) [IF=8.7]

Application: IHC    Species: mouse    Sample:

Fig3. Pro-osteogenic implants inhibited NF-κB and NLRP3 signaling pathways accompanied with less NETs. (A-C) In neutrophil cluster of scRNA-seq, Gene Set Enrichment Analysis (GSEA) revealed the expression values of genes associated with NADP+1 - oxidoreductase activity, cell death in response to oxidative stress, and chromatin disassembly. (D) Volcano plot depicting the DEGs between various groups. Purple symbols indicate upregulated genes; green symbols indicate downregulated genes (log10 FDR < -1, log2 FC > 0.5). (E-G) Representative immunohistochemistry staining images and quantitative analysis of NE-positive and MPO-positive cells around implants at 3 days post-implantation. Scale bar: 100 μm, n=6. (H, I) Representative immunoblot images and semi-quantitative analysis of NE (H) and MPO (I) in neutrophils cultured on different implant materials for 12 h, n=6 independent experimental replicates. (J) Representative scanning electron microscopy (SEM) images of the NETosis (outlined by the white dotted line) induced by different surfaces at 4, 8, 12, and 24 h, respectively. Scale bar: 10 μm. (K) Represetnative immunofluorescent staining images and quantitative analysis of MPO (red), DNA component (SYTOX, green), and nucleus (blue) in neutrophils after 12 and 24 h. Scale bar:10 μm, n=6 independent experimental replicates. (L, M) Representative immunoblot images and semi-quantitative analysis of the phosphorylation levels in the NF-κB signaling pathway. (N) Transcriptional levels of genes associated with the NLRP3 signaling pathway, including Nlrp3, Asc, Caspase-1, Il-1β, and Il- 18. (O-S) Representative immunoblots and semi-quantitative analysis of the NLRP3 signaling pathway. n=6 independent experimental replicates. Data are means ± s.e.m. and ANOVA with Tukey’s post-hoc correction for multiple comparisons,

3). The combination of paeoniflorin and hydroxysafflor yellow A alleviated pulmonary thrombosis by inhibiting platelet-neutrophil interaction via the P-selectin-PSGL-1 signaling axis. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2026 (PubMed: 41763135) [IF=6.7]

4). Neutrophil extracellular traps promote gastric cancer metastasis by inducing epithelial‑mesenchymal transition. INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE, 2021 (PubMed: 34013374) [IF=5.7]

Application: WB    Species: Human    Sample: GC tissues

Figure 3 Abundant NET deposition in human GC tissues. (A) NETs were visualized in GC tissues as extracellular structures decorated with neutrophil elastase (green) and citrullinated H3 (red) co-localizing with DAPI/DNA (blue), but the lack of NETs in normal resection edge. Scale bar, 50 µm; magnification, ×400. (B) Western blot analysis results revealed that the level of cit-H3 was increased in the gastric cancer tissues but nearly absence in normal gastric tissues. The blots are representatives of 3 experiments from 10 pairs of patients with similar results. (C) The values of protein band densities were normalized to cit-h3 protein level of normal group. Data are shown as the means ± SEM, #P<0.001 vs. normal group. NET, neutrophil extracellular trap; GC, gastric cancer; cit-h3, citrullinated histone H3.

Application: IF/ICC    Species: mouse    Sample: tumor

Figure 5.| Effects of NET inhibitors on solid tumor growth in nude mice.(E) Images showing representative immunostaining for neutrophil elastase (green), citrullinated histone H3 (red), and DAPI (blue) in the tumors of mice treated as indicated; scale bar, 50 µm; magnification, x400.

5). Peptidylarginine deiminase 4-mediated neutrophil extracellular trap formation aggravates β-cell damage in type 1 diabetes: A multi-model study. Diabetes, obesity & metabolism, 2026 (PubMed: 41607298) [IF=5.4]

6). IgD enhances the release of neutrophil extracellular traps (NETs) via FcδR in rheumatoid arthritis patients. International Immunopharmacology, 2023 (PubMed: 36450207) [IF=4.8]

7). Integration analysis of transcriptomics revealed NETosis heterogeneity and Ncf1 as a prognostic biomarker in neutrophil asthma. International immunopharmacology, 2025 (PubMed: 40499471) [IF=4.8]

8). Dihydromyricetin ameliorates experimental ulcerative colitis by inhibiting neutrophil extracellular traps formation via the HIF-1α/VEGFA signaling pathway. International immunopharmacology, 2024 (PubMed: 38955027) [IF=4.8]

9). Integrative analysis of network pharmacology and proteomics reveal the protective effect of Xiaoqinglong Decotion on neutrophilic asthma. Journal of ethnopharmacology, 2024 (PubMed: 38561057) [IF=4.8]

10). Transcriptomics Reveals Effect of Pulsatilla Decoction Butanol Extract in Alleviating Vulvovaginal Candidiasis by Inhibiting Neutrophil Chemotaxis and Activation via TLR4 Signaling. Pharmaceuticals (Basel, Switzerland), 2024 (PubMed: 38794163) [IF=4.6]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.