BPIL1 Antibody - #DF12570
| Product: | BPIL1 Antibody |
| Catalog: | DF12570 |
| Description: | Rabbit polyclonal antibody to BPIL1 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Dog |
| Mol.Wt.: | 49 kDa(Observed); 49kD(Calculated). |
| Uniprot: | Q8N4F0 |
| RRID: | AB_2845532 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12570, RRID:AB_2845532.
Fold/Unfold
Bactericidal permeability increasing protein like 1; Bactericidal/permeability-increasing protein-like 1; BPI fold-containing family B member 2; BPI-like 1; BPIB2_HUMAN; Bpifb2; C20orf184; dJ726C3.2; Long palate; Long palate lung and nasal epithelium carcinoma associated 2; Long palate lung and nasal epithelium carcinoma associated protein 2; LPLUNC2; lung and nasal epithelium carcinoma-associated protein 2; OTTHUMP00000030612; RYSR;
Immunogens
A synthesized peptide derived from human BPIL1, corresponding to a region within the internal amino acids.
Highly expressed in tonsils, especially in hypertrophic tonsils. Detected at very low levels in fetal liver.
- Q8N4F0 BPIB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Secreted.
Highly expressed in tonsils, especially in hypertrophic tonsils. Detected at very low levels in fetal liver.
Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.